KEGG   Homo sapiens (human): 89884
Entry
89884             CDS       T01001                                 

Gene name
LHX4, CPHD4
Definition
(RefSeq) LIM homeobox 4
  KO
K09374  LIM homeobox protein 3/4
Organism
hsa  Homo sapiens (human)
Disease
H00254  Growth hormone deficiency
H02036  Combined pituitary hormone deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    89884 (LHX4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    89884 (LHX4)
SSDB
Motif
Pfam: LIM Homeodomain Homeobox_KN Furin-like_2
Other DBs
NCBI-GeneID: 89884
NCBI-ProteinID: NP_203129
OMIM: 602146
HGNC: 21734
Ensembl: ENSG00000121454
Vega: OTTHUMG00000035115
Pharos: Q969G2(Tbio)
UniProt: Q969G2 A0A0S2Z5S4
Structure
PDB: 
5HOD

Position
1q25.2
AA seq 390 aa
MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPT
SDISTGSSVGYPDFPTSPGSWLDEMDHPPF
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgatgcagagtgcgactgtccccgcggaaggggctgtcaaggggctcccggagatgcta
ggtgtgccgatgcaacagattccccagtgcgctggctgcaaccagcacatcctggacaag
ttcatcctgaaggtcctggacagacactggcacagctcctgcctcaagtgtgcagactgc
cagatgcagctggcggacaggtgcttctccagggctgggagcgtctactgcaaggaggac
ttcttcaagcgcttcggcacaaaatgcacggcctgccagcagggtatccccccaacccag
gtggtccgcaaggcccaggactttgtctaccacctgcactgctttgcttgcatcatctgc
aaccggcagctggccacgggggacgaattctacctcatggaggacgggcggctggtgtgc
aaggaagactacgagacagccaagcagaacgatgactcagaggctggagctaagcggccc
cggaccaccatcacagccaagcagctggagacattaaagaatgcatacaagaactccccc
aagcctgcccggcacgtgagggagcagctgtcctcagagacaggcctggacatgagggtc
gtacaggtttggtttcagaacagaagggccaaagagaaacgcctgaagaaggatgcaggg
cggcaccgctgggggcagttctataagagcgtcaagaggagccggggcagcagcaagcag
gagaaggagagctctgcagaggactgtggggttagtgacagtgagctgagcttccgagag
gatcaaattctctcagaacttggccacaccaataggatttatggcaacgtgggggacgtt
acaggcggacagttaatgaatgggagcttctccatggacgggacaggacaatcctatcag
gacttgagggatgggagcccctatggaatcccccagtctccatcctccatatcgtccctg
ccatcccacgctcctttgctcaatgggctggattacacggtggacagtaatttgggcatc
attgcgcatgcagggcagggagtaagccagacgctgagagccatggctgggggacccacc
tctgacatctccacaggaagcagtgtaggctatcccgactttccaactagcccaggctct
tggctcgatgaaatggatcatcctcctttttaa

DBGET integrated database retrieval system