KEGG   Homo sapiens (human): 89890Help
Entry
89890             CDS       T01001                                 

Gene name
KBTBD6
Definition
(RefSeq) kelch repeat and BTB domain containing 6
  KO
K10474  kelch repeat and BTB domain-containing protein 6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    89890 (KBTBD6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     89890 (KBTBD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB BACK Kelch_1 Kelch_6 Kelch_3 Kelch_4 Kelch_2 DUF3342 PT-TG
Motif
Other DBs
NCBI-GeneID: 89890
NCBI-ProteinID: NP_690867
OMIM: 617738
HGNC: 25340
Ensembl: ENSG00000165572
Vega: OTTHUMG00000016786
Pharos: Q86V97(Tdark)
UniProt: Q86V97
Position
13q14.11
AA seq 674 aa AA seqDB search
MQSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAE
SFEVLVDYCYTGRVSLSEANVERLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFA
DAFGHRKLRSQAQSYIAQNFKQLSHMGSIREETLADLTLAQLLAVLRLDSLDVESEQTVC
HVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQ
MRYGDLLYKSLVPVPNSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFGHPRDPFLCCD
PYSGDLYKVPSPLTCLAHTRTVTTLAVCISPDHDIYLAAQPRTDLWVYKPAQNSWQQLAD
RLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYNVKRNQWALVAPLPHSFLSFDLM
VIRDYLYALNSKRMFCYDPSHNMWLKCVSLKRNDFQEACVFNEEIYCICDIPVMKVYNPV
RAEWRQMNNIPLVSETNNYRIIKHGQKLLLITSRTPQWKKNRVTVYEYDIRGDQWINIGT
TLGLLQFDSNFFCLSARVYPSCLEPGQSFLTEEEEIPSESSTEWDLGGFSEPDSESGSSS
SLSDDDFWVRVAPQ
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcccgggaagacgccccgcgctctcgccgcctagccagtccccgtggtgggaag
cggcccaagaagattcacaaacccacagtttcggcctttttcacgggtccagaggaatta
aaggacacggcccattctgcagccctgctggcacagctcaagtccttctacgatgcgcgg
ctgctgtgtgatgtgaccatcgaggtggtgacgcctggcagcgggcctggcacgggtcgc
ctgttcccctgcaaccgcaatgtgctggccgcggcatgtccctacttcaagagcatgttc
acaggtggcatgtacgagagccagcaggccagcgtgaccatgcacgatgtggacgccgag
tccttcgaggtgttggtcgactactgctacacgggtcgtgtgtctctcagtgaggccaac
gtggagcgcctgtacgcggcctccgacatgctacagctggaatatgtgcgggaagcctgt
gcctccttcttagcccgacgtcttgacctgaccaactgcaccgccatcctcaagtttgca
gatgcctttggccatcgcaagctgcgatcccaggcccagtcctatatagctcagaacttc
aagcaactcagccacatgggttcaattcgggaggagactctagcagatctgaccctggcc
cagctgctggctgtcctgcgcttggatagtctggacgtggagagtgagcagacagtgtgc
catgtggcagtgcagtggctggaggctgctcccaaagagcggggtcccagtgctgcagaa
gtcttcaagtgcgtgcgctggatgcacttcactgaagaagatcaggactacttagaaggg
ctgctgaccaagcccatcgtgaagaagtactgcctggacgttattgaaggggccctgcag
atgcgctatggtgacctgttgtacaagtctctggtgccagtgccaaacagcagcagcagc
agtagcagcagcaactctcttgtatctgcagcagaaaatccaccccagagactgggtatg
tgtgccaaggagatggtgatcttctttggacaccccagagatccctttctctgctgtgat
ccatactcgggggacctttacaaagtgccgtcacctttgacctgtctggctcacactagg
actgtcaccactctagctgtctgtatctctcctgaccatgacatctatctagctgctcag
cccaggacagacctctgggtgtataaaccagctcagaatagttggcagcaacttgcagat
cgcttgctgtgtcgtgagggcatggatgtggcatatctcaatggctatatctacattttg
ggggggcgagaccctattactggagttaagttgaaggaagtggaatgctacaatgttaag
agaaaccagtgggcattggtggctccactgccccattcttttttatcctttgacctaatg
gtaattcgagactatctctatgctctcaacagtaagcgcatgttctgttatgatcctagc
cacaatatgtggctgaagtgcgtttctctgaagcgcaatgactttcaggaagcctgcgtc
ttcaatgaggagatctattgtatctgtgatatcccagtcatgaaggtctacaacccagtt
agggcagaatggaggcaaatgaataatattcccttggtctcagagaccaacaactacaga
attatcaagcatggccaaaaattgttgctcatcacctctcgcaccccacagtggaaaaag
aaccgggtgactgtgtatgaatatgatattaggggagaccaatggattaatataggtacc
acattaggcctcttgcagtttgattctaactttttttgcctctctgctcgtgtttatcct
tcctgccttgaacctggtcagagtttcctcactgaagaagaagaaataccaagtgagtct
agcactgaatgggacttaggtggattcagtgagccagactctgagtcaggaagttcaagt
tctctttctgatgatgatttttgggtgcgtgtagcgcctcagtga

DBGET integrated database retrieval system