KEGG   Homo sapiens (human): 8995
Entry
8995              CDS       T01001                                 

Gene name
TNFSF18, AITRL, GITRL, TL6, TNLG2A, hGITRL
Definition
(RefSeq) TNF superfamily member 18
  KO
K05479  tumor necrosis factor ligand superfamily member 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8995 (TNFSF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    8995 (TNFSF18)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   8995 (TNFSF18)
SSDB
Motif
Pfam: TNF zf-LITAF-like
Other DBs
NCBI-GeneID: 8995
NCBI-ProteinID: NP_005083
OMIM: 603898
HGNC: 11932
Ensembl: ENSG00000120337
Vega: OTTHUMG00000034835
Pharos: Q9UNG2(Tbio)
UniProt: Q9UNG2 A0A0U5JXL4
Structure
PDB: 
3B93 2Q1M 3B94 2R30

Position
1q25.1
AA seq 177 aa
MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMA
KFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKN
KDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
NT seq 534 nt   +upstreamnt  +downstreamnt
atgtgtttgagccacttggaaaatatgcctttaagccattcaagaactcaaggagctcag
agatcatcctggaagctgtggctcttttgctcaatagttatgttgctatttctttgctcc
ttcagttggctaatctttatttttctccaattagagactgctaaggagccctgtatggct
aagtttggaccattaccctcaaaatggcaaatggcatcttctgaacctccttgcgtgaat
aaggtgtctgactggaagctggagatacttcagaatggcttatatttaatttatggccaa
gtggctcccaatgcaaactacaatgatgtagctccttttgaggtgcggctgtataaaaac
aaagacatgatacaaactctaacaaacaaatctaaaatccaaaatgtaggagggacttat
gaattgcatgttggggacaccatagacttgatattcaactctgagcatcaggttctaaaa
aataatacatactggggtatcattttactagcaaatccccaattcatctcctag

DBGET integrated database retrieval system