KEGG   Homo sapiens (human): 89958
Entry
89958             CDS       T01001                                 
Symbol
SAPCD2, C9orf140, p42.3
Name
(RefSeq) suppressor APC domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Suppressor_APC
Other DBs
NCBI-GeneID: 89958
NCBI-ProteinID: NP_848543
OMIM: 612057
HGNC: 28055
Ensembl: ENSG00000186193
Vega: OTTHUMG00000020961
Pharos: Q86UD0(Tbio)
UniProt: Q86UD0
Position
9:complement(137062127..137070557)
AA seq 394 aa
MAGAAMAERGRVPPPAPAPSTEGLPRAFLQSLRTLFDILDDRRRGCVHLREIESRWQGTD
ARELPRGVLEGLRQVAPASGYLTFERFVAGLRTSLLSADGGPRDPTRAPARPGDQPPPPP
QRLVFAPADEPRTVLERKPLPLGVRAPLAGPSAAARSPEQLCAPAEAAPCPAEPERSQSA
ALEPSSSADAGAVACRALEADSGDARRAPRARGERRRHTIASGVDCGLLKQMKELEQEKE
VLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSPRPLGRLLPKVQEVAR
CLGELLAAACASRALPPSSSGPPCPALTSTSPPVWQQQTILMLKEQNRLLTQEVTEKSER
ITQLEQEKSALIKQLFEARALSQQDGGPLDSTFI
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggccggggccgccatggccgagcggggccgcgtgcctccccccgcacccgcgcccagc
acggaggggctgccgcgcgccttcctgcagagcctgcgcaccctgttcgacatcctggac
gaccggcggcgcggctgcgtgcacctgcgcgagatcgagtcccgctggcagggcaccgac
gcgcgggagctgccccgcggggtgctggagggcttgcgccaggtggccccggccagcggc
tacctgaccttcgagcgcttcgtggccggcctgcgcacctccctgctgagcgccgacggc
ggcccccgggaccccacgcgcgccccggcccggcccggggatcagccgccgccgccgccg
cagcgcctggtgttcgctccggccgacgagccgcggacggtcctggagaggaagcccctg
cccctgggcgtgcgcgcccctctggccggtcccagcgccgccgcccgcagcccggagcag
ctgtgcgccccggctgaggcggcgccctgccccgcggagcccgagcggtcccagagcgcg
gcgctggaaccgagctccagcgcggacgcaggtgcagtggcgtgcagggccctggaggcg
gactcaggggatgcccggcgggctccccgtgcccgaggggaacgtcggaggcacaccatc
gccagcggcgtggactgcggcctgctgaagcagatgaaggagctggagcaggagaaggag
gtgctgctgcagggtttggagatgatggcgcggggccgcgactggtaccagcagcagctg
caacgagtgcaggagcgccagcgccgcctgggccagagcagagccagcgccgactttggg
gctgcagggagcccccgcccactggggcggctactgcccaaggtacaagaggtggcccgg
tgcctgggggagctgctggctgcagcctgtgccagccgggccctgcccccgtcctcctcc
gggcccccctgccctgccctgacgtccacctcacccccggtctggcagcagcagaccatc
ctcatgctgaaggagcagaaccgactcctcacccaggaggtgaccgagaagagtgagcgc
atcacgcagctggagcaggagaagtcggcgctcattaagcagctgtttgaggcccgcgcc
ctgagccagcaggacgggggacctctggattccaccttcatctag

DBGET integrated database retrieval system