KEGG   Homo sapiens (human): 89978
Entry
89978             CDS       T01001                                 
Symbol
DPH6, ATPBD4
Name
(RefSeq) diphthamine biosynthesis 6
  KO
K06927  diphthine-ammonia ligase [EC:6.3.1.14]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    89978 (DPH6)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.14  diphthine---ammonia ligase
     89978 (DPH6)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    89978 (DPH6)
SSDB
Motif
Pfam: Diphthami_syn_2
Other DBs
NCBI-GeneID: 89978
NCBI-ProteinID: NP_542381
OMIM: 618391
HGNC: 30543
Ensembl: ENSG00000134146
Pharos: Q7L8W6(Tdark)
UniProt: Q7L8W6
Position
15:complement(35144977..35546165)
AA seq 267 aa
MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDL
YAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSD
YQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTL
DQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYL
RFLELHLEDKVSSVPDNYRTSNYIYNF
NT seq 804 nt   +upstreamnt  +downstreamnt
atgagggtcgcggctctgatcagtggtgggaaggacagctgctataatatgatgcagtgc
attgctgctgggcatcagatcgttgctttagcaaatctaagaccagctgaaaaccaagtg
gggtctgatgaactggatagctacatgtatcagacagtggggcaccatgccattgacttg
tatgcagaagcaatggctcttcccctctatcgccgaaccataagaggaaggagcttggat
acaagacaagtgtacaccaaatgtgaaggtgatgaggttgaagatctctatgagcttttg
aaacttgttaaggaaaaagaagaagtagaggggatatcagtaggtgctatactttctgac
tatcagcgtattcgagtggaaaatgtgtgtaaaaggcttaatctccagcctttagcttat
ctttggcagagaaaccaggaagatttgctcagagagatgatatcatctaacattcaagca
atgatcatcaaagtagcagctttgggtttagatcctgataagcatcttgggaaaaccctg
gatcaaatggagccttatctcatagagctttctaagaagtatggagtacatgtttgtgga
gaaggtggagagtatgaaactttcactttggattgccctctatttaagaagaaaataatt
gtggattcatcagaagtagtcatacattcagctgatgcatttgcacctgtggcttatcta
cgctttttagaattgcacttggaggacaaggtgtcctcagtgcctgacaactacagaaca
tctaattatatatataatttttga

DBGET integrated database retrieval system