KEGG   Homo sapiens (human): 9Help
Entry
9                 CDS       T01001                                 

Gene name
NAT1, AAC1, MNAT, NAT-1, NATI
Definition
(RefSeq) N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00232  Caffeine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    9 (NAT1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    9 (NAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    9 (NAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     9 (NAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 9
NCBI-ProteinID: NP_000653
OMIM: 108345
HGNC: 7645
Ensembl: ENSG00000171428
Vega: OTTHUMG00000097001
Pharos: P18440(Tchem)
UniProt: P18440
Structure
PDB: 

Position
8p22
AA seq 290 aa AA seqDB search
MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV
RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI
VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL
LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT
HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatatcttgaaagaattggctataagaagtctaggaacaaattggac
ttggaaacattaactgacattcttcaacaccagatccgagctgttccctttgagaacctt
aacatccattgtggggatgccatggacttaggcttagaggccatttttgatcaagttgtg
agaagaaatcggggtggatggtgtctccaggtcaatcatcttctgtactgggctctgacc
actattggttttgagaccacgatgttgggagggtatgtttacagcactccagccaaaaaa
tacagcactggcatgattcaccttctcctgcaggtgaccattgatggcaggaactacatt
gtcgatgctgggtttggacgctcataccagatgtggcagcctctggagttaatttctggg
aaggatcagcctcaggtgccttgtgtcttccgtttgacggaagagaatggattctggtat
ctagaccaaatcagaagggaacagtacattccaaatgaagaatttcttcattctgatctc
ctagaagacagcaaataccgaaaaatctactcctttactcttaagcctcgaacaattgaa
gattttgagtctatgaatacatacctgcagacatctccatcatctgtgtttactagtaaa
tcattttgttccttgcagaccccagatggggttcactgtttggtgggcttcaccctcacc
cataggagattcaattataaggacaatacagatctaatagagttcaagactctgagtgag
gaagaaatagaaaaagtgctgaaaaatatatttaatatttccttgcagagaaagcttgtg
cccaaacatggtgatagattttttactatttag

DBGET integrated database retrieval system