KEGG   Homo sapiens (human): 90Help
Entry
90                CDS       T01001                                 

Gene name
ACVR1, ACTRI, ACVR1A, ACVRLK2, ALK2, FOP, SKR1, TSRI
Definition
(RefSeq) activin A receptor type 1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00430  Fibrodysplasia ossificans progressiva
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    90 (ACVR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    90 (ACVR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    90 (ACVR1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    90 (ACVR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    90 (ACVR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     90 (ACVR1)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   90 (ACVR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 90
NCBI-ProteinID: NP_001096
OMIM: 102576
HGNC: 171
Ensembl: ENSG00000115170
Vega: OTTHUMG00000131967
Pharos: Q04771(Tchem)
UniProt: Q04771 D3DPA4
Structure
PDB: 

Position
2q24.1
AA seq 509 aa AA seqDB search
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtagatggagtgatgattcttcctgtgcttatcatgattgctctcccctcccctagt
atggaagatgagaagcccaaggtcaaccccaaactctacatgtgtgtgtgtgaaggtctc
tcctgcggtaatgaggaccactgtgaaggccagcagtgcttttcctcactgagcatcaac
gatggcttccacgtctaccagaaaggctgcttccaggtttatgagcagggaaagatgacc
tgtaagaccccgccgtcccctggccaagccgtggagtgctgccaaggggactggtgtaac
aggaacatcacggcccagctgcccactaaaggaaaatccttccctggaacacagaatttc
cacttggaggttggcctcattattctctctgtagtgttcgcagtatgtcttttagcctgc
ctgctgggagttgctctccgaaaatttaaaaggcgcaaccaagaacgcctcaatccccga
gacgtggagtatggcactatcgaagggctcatcaccaccaatgttggagacagcacttta
gcagatttattggatcattcgtgtacatcaggaagtggctctggtcttccttttctggta
caaagaacagtggctcgccagattacactgttggagtgtgtcgggaaaggcaggtatggt
gaggtgtggaggggcagctggcaaggggagaatgttgccgtgaagatcttctcctcccgt
gatgagaagtcatggttcagggaaacggaattgtacaacactgtgatgctgaggcatgaa
aatatcttaggtttcattgcttcagacatgacatcaagacactccagtacccagctgtgg
ttaattacacattatcatgaaatgggatcgttgtacgactatcttcagcttactactctg
gatacagttagctgccttcgaatagtgctgtccatagctagtggtcttgcacatttgcac
atagagatatttgggacccaagggaaaccagccattgcccatcgagatttaaagagcaaa
aatattctggttaagaagaatggacagtgttgcatagcagatttgggcctggcagtcatg
cattcccagagcaccaatcagcttgatgtggggaacaatccccgtgtgggcaccaagcgc
tacatggcccccgaagttctagatgaaaccatccaggtggattgtttcgattcttataaa
agggtcgatatttgggcctttggacttgttttgtgggaagtggccaggcggatggtgagc
aatggtatagtggaggattacaagccaccgttctacgatgtggttcccaatgacccaagt
tttgaagatatgaggaaggtagtctgtgtggatcaacaaaggccaaacatacccaacaga
tggttctcagacccgacattaacctctctggccaagctaatgaaagaatgctggtatcaa
aatccatccgcaagactcacagcactgcgtatcaaaaagactttgaccaaaattgataat
tccctcgacaaattgaaaactgactgttga

DBGET integrated database retrieval system