KEGG   Homo sapiens (human): 900
Entry
900               CDS       T01001                                 

Gene name
CCNG1, CCNG
Definition
(RefSeq) cyclin G1
  KO
K10145  cyclin G1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    900 (CCNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    900 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 900
NCBI-ProteinID: NP_004051
OMIM: 601578
HGNC: 1592
Ensembl: ENSG00000113328
Vega: OTTHUMG00000130380
Pharos: P51959(Tbio)
UniProt: P51959
Position
5q34
AA seq 295 aa
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatagaggtactgacaacaactgactctcagaaactgctacaccagctgaatgccctg
ttggaacaggagtctagatgtcagccaaaggtctgtggtttgagactaattgagtctgca
cacgataatggcctcagaatgactgcaagactaagggactttgaagtaaaagatcttctt
agtctaactcagttctttggctttgacacagagacattttctctagctgtgaatttactg
gacagattcctgtctaaaatgaaggtacagcccaagcaccttgggtgtgttggactgagc
tgcttttatttggctgtaaaatcaatagaagaggaaaggaatgtcccattggcaactgac
ttgatccgaataagtcaatataggtttacggtttcagacttgatgagaatggaaaagatt
gtattggagaaggtgtgttggaaagtcaaagctactactgcctttcaatttctgcaactg
tattattcactccttcaagagaacttgccacttgaaaggagaaatagcattaattttgaa
agactagaagctcaactgaaggcatgtcattgcaggatcatattttctaaagcaaagcct
tctgtgttggcattgtctatcattgcattagagatccaagcacagaagtgtgtagagtta
acagaaggaatagaatgtcttcagaaacattccaagataaatggcagagatctgaccttc
tggcaagagcttgtatccaaatgtttaactgaatattcatcaaataagtgttccaaacca
aatgttcagaagttgaaatggattgtttctgggcgtactgcacggcaattgaagcatagc
tactacagaataactcaccttccaacaattcctgaaatggtcccttaa

KEGG   Homo sapiens (human): 901
Entry
901               CDS       T01001                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin G2
  KO
K10146  cyclin G2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    901 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    901 (CCNG2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 901
NCBI-ProteinID: NP_004345
OMIM: 603203
HGNC: 1593
Ensembl: ENSG00000138764
Vega: OTTHUMG00000130100
Pharos: Q16589(Tbio)
UniProt: Q16589 A0A024RDC7
Position
4q21.1
AA seq 344 aa
MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKV
EDLRSLANFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIP
STHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHTIILCHTSERKEIL
SLDKLEAQLKACNCRLIFSKAKPSVLALCLLNLEVETLKSVELLEILLLVKKHSKINDTE
FFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFD
ESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaaggatttgggggcagagcacttggcaggtcatgaaggggtccaacttctcgggttg
ttgaacgtctacctggaacaagaagagagattccaacctcgagaaaaagggctgagtttg
attgaggctaccccggagaatgataacactttgtgtccaggattgagaaatgccaaagtt
gaagatttaaggagtttagccaacttttttggatcttgcactgaaacttttgtcctggct
gtcaatattttggacaggttcttggctcttatgaaggtgaaacctaaacatttgtcttgc
attggagtctgttcttttttgctggctgctagaatagttgaagaagactgcaatattcca
tccactcatgatgtgatccggattagtcagtgtaaatgtactgcttctgacataaaacgg
atggaaaaaataatttcagaaaaattgcactatgaattggaagctactactgccttaaac
tttttgcacttataccatactattatactttgtcatacttcagaaaggaaagaaatactg
agccttgataaactagaagctcagctgaaagcttgcaactgccgactcatcttttcaaaa
gcaaaaccatctgtattagccttgtgccttctcaatttggaagtggaaactttgaaatct
gttgaattactggaaattctcttgctagttaaaaaacattccaagattaatgacactgag
ttcttctactggagagagttggtttctaaatgcctagccgagtattcttctcctgaatgt
tgcaaaccagatcttaagaagttggtttggatcgtttcaaggcgcacagcccagaacctc
cacaacagctactatagtgttcctgagctgccaacgatacctgaggggggttgttttgat
gaaagtgaaagtgaggactcttgtgaagatatgagttgtggagaggagagtctcagcagc
tctcctcccagtgatcaagagtgcaccttctttttcaacttcaaagtggcacaaacactg
tgctttccatcttag

DBGET integrated database retrieval system