KEGG   Homo sapiens (human): 90113Help
Entry
90113             CDS       T01001                                 

Gene name
VWA5B2
Definition
(RefSeq) von Willebrand factor A domain containing 5B2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: VWA_3 VIT_2 VIT
Motif
Other DBs
NCBI-GeneID: 90113
NCBI-ProteinID: NP_612354
HGNC: 25144
Ensembl: ENSG00000145198
Vega: OTTHUMG00000156820
Pharos: Q8N398(Tdark)
UniProt: Q8N398 Q9BVH8
Position
3q27.1
AA seq 1242 aa AA seqDB search
MPGLYCPSSWTPLPLTDSWVRACANGPCLSVRARLTYRNPQPQPVDGVFVYPLAEAEVVS
GFEAEAAGRRVSFQLQSRRRSQAACCRALGPGLGTPTPRRCAQGHLVLDLAQARSTLVLP
TGIIAAAGTMTVTLHSSRELPSRPDGVLHVALPTVLTPLAPPGPPGPPRPPGLCDDSPTS
CFGVGSLQEEGLAWEELAAPRDVFSGPARCPAPYTFSFEMLVTGPCLLAGLESPSHALRA
DAPPHASSAATICVTLAEGHHCDRALEILLHPSEPHQPHLMLEGGSLSSAEYEARVRARR
DFQRLQRRDSDGDRQVWFLQRRFHKDILLNPVLALSFCPDLSSKPGHLGTATRELLFLLD
SSSVAHKDAIVLAVKSLPPQTLINLAVFGTLVQPLFPESRPCSDDAVQLICESIETLQVP
SGPPDVLAALDWAVGQPQHRAYPRQLFLLTAASPMAATTHRTLELMRWHRGTARCFSFGL
GPTCHQLLQGLSALSRGQAYFLRPGQRLQPMLVQALRKALEPALSDISVDWFVPDTVEAL
LTPREIPALYPGDQLLGYCSLFRVDGFRSRPPGGQEPGWQSSGGSVFPSPEEAPSAASPG
TEPTGTSEPLGTGTVSAELSSPWAARDSEQSTDALTDPVTDPGPNPSDTAIWRRIFQSSY
IREQYVLTHCSASPEPGPGSTGSSESPGSQGPGSPEGSAPLEPPSQQGCRSLAWGEPAGS
RSCPLPAPTPAPFKVGALSTEVLGRQHRAALAGRSLSSPPGRANQVPGRPRKPSLGAILD
GPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCH
VVIRGLCGEQPMCWEVGVGLETLWGPGDGSQPPSPPVREAAWDQALHRLTAASVVRDNEQ
LALRGGAETTADRGHARRCWLRALQTSKVSSAPSCFTCPVAVDATTREVLPGALQVCSSE
PAEPPGTPPASHSHLDAAPLPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGP
RRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYLPLVRLQEAPGSFRLDAPFCAAV
RISQERLCRASPFAVHRASLSPTSASLPWALLGPGVGQGDSATASCSPSPSSGSEGPGQV
DSGRGSDTEASEGAEGLGGTDLRGRTWATAVALAWLEHRCAAAFDEWELTAAKADCWLRA
QHLPDGLDLAALKAAARGLFLLLRHWDQNLQLHLLCYSPANV
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcctgtactgcccctccagctggacgccgctgccgctcacggactcctgggtc
cgggcctgcgccaacggcccctgcctcagcgtgcgggcccggctcacctaccgcaacccg
cagccgcagccggtggacggcgtgttcgtgtacccgctggccgaggccgaggtggtgtcc
ggcttcgaggccgaggccgccggacggcgcgtctccttccagctgcagagccggcgccgc
tcgcaggccgcctgctgccgcgctctgggcccggggctggggaccccgacgccccgccgc
tgcgcgcagggtcatcttgtcttggatctggcccaggcccggtccacgttggtgctgccc
acaggcattatcgccgcggctggcaccatgacggtgaccctgcacagcagccgggagctg
ccctcaaggcctgacggggtgctgcatgtggccctgcccactgtgctcaccccgctggcc
ccgccaggcccgccggggccccccaggcctccggggctctgtgacgacagccccaccagc
tgcttcggggtgggcagccttcaggaggaagggctggcctgggaggagctggctgcccct
cgggacgtgttctcaggccctgcccgctgccctgccccatataccttctccttcgagatg
ctggtgactgggccatgcctgcttgcaggcctggagagcccctctcatgctctgcgggca
gatgccccccctcatgccagctctgcagccaccatctgtgtcacactggcagagggccac
cactgtgaccgggccttggagatcctgctgcaccccagtgagccccatcagccacacctg
atgctggagggcggcagcctgagctcagcagaatatgaggcccgggtgagggcccgccga
gattttcagaggctacagcgaagggacagtgatggggaccggcaggtgtggttcctgcag
cgacgcttccacaaggacatcctgctgaaccccgtgctggcgctgagcttctgcccagac
ctgagctccaagcccggacacctggggacagctactcgggagctactcttccttttggat
agcagcagcgtggcacacaaggatgccattgttttggctgtgaagtccctcccgccccag
acgcttatcaacctggccgtgtttgggacgttggtgcagccactcttcccagagagccgg
ccttgcagtgatgatgctgtgcagctgatctgcgagagcattgagaccctgcaggttccg
agtgggcccccagacgtgctggctgctctggactgggccgtggggcagccccagcacagg
gcctaccctcggcagctgttcctgctcactgctgcctcacccatggccgccactacccac
cgaaccctggagctcatgaggtggcacagggggacagccagatgcttctcctttgggctg
gggcccacctgccaccagctgctccagggtttatctgccctcagcagaggccaggcctac
ttcctgaggcctgggcagaggctgcagcccatgctggtacaggctctgcggaaggcactg
gagcctgctttgagtgacatctctgtggactggtttgtgcccgacactgtggaggcactg
ctgaccccccgggagatcccagcactctaccctggggaccagctgctcggttactgctca
ctcttcagggtggatggcttccggtcccgcccaccagggggccaagagcctggctggcag
agctcgggtgggtccgtgtttccatccccagaagaggccccgtctgctgccagccctggc
actgagcccactggcacctcagagccactgggaacaggcactgtctcagcagaactgtcc
agcccatgggctgccagggactcggagcagagtactgatgctctgacagacccagtcacg
gatcctggacccaacccctctgacacagccatatggcgccgcatctttcagtcctcgtac
attcgggagcagtatgtgctcacccactgctctgccagccccgagccaggcccaggctcc
acaggcagcagtgagtccccaggctcacagggccctggctcccccgaaggtagtgctccc
ttggagcccccttctcagcagggctgccgcagtctggcctggggagaacctgcaggctcc
cgctcctgtcccctgcctgcacccacaccagctccattcaaggtgggggccttgagtact
gaggtgctgggccgtcagcacagagcggctctggctggccgaagcctctcatcccctcca
ggccgggcaaaccaagtccccggccgaccccggaaaccctctttgggtgcaatactagat
ggcccaagtcctgagccaggccaacagttgggacaaggcctggatgactcaggaaacctg
ctctccccagcccctatggactgggacatgctgatggaaccacccttcttattcacggct
gtgcctcctagtggggagttggcccctccagcagtgcctccccaggctccacgctgccat
gtggtgatccggggcctgtgtggggagcagcccatgtgctgggaggtgggtgttgggctg
gagacactgtggggacctggagatggctcacagcctccctcacctcctgtaagagaagct
gcttgggaccaagcactccatcggctgacagcagcctctgtggtccgggacaatgagcag
ctggccctccgaggaggggcagagaccacagctgaccggggccatgcccggaggtgctgg
cttcgagcccttcagacaagtaaggtcagctctgccccctcctgcttcacttgccctgta
gctgtggatgctactactagggaggtcctgcctggggccctgcaggtgtgcagctcagag
cccgctgagcccccaggaacccctcctgcctctcacagccatctagatgcagctcctctg
cccactgttgtctactctaaaggacttcagagaggctctccagcaggcgcctgggactcg
gaccaaaatggcaactccaagcgtgctttgggggaccctgccactcccacggaaggtcct
cgccgcccacctccccgtcctccctgtcggctcagcatgggccgccgtcacaaactctgt
agccctgacccgggccaggccaacaacagtgaaggcagcgaccatgactacctgcccttg
gtgcggctgcaggaggcaccaggctccttccgcctggacgcgcccttctgcgccgctgtg
cgcatctcgcaggagcgcctctgccgtgcctcgccctttgccgtgcaccgcgccagcctc
agccccacctcggcctcattgccctgggcacttctgggccctggtgttggccagggtgac
agtgccacggcctcctgcagcccgtcccccagctcgggctctgaggggccaggccaggtg
gacagtgggcggggctcagacaccgaggcctccgagggggcggaagggctgggcggcacc
gacctgcggggccggacctgggccactgccgtagcactcgcctggctggagcaccgatgc
gccgctgccttcgacgagtgggaactgacagcggccaaggctgattgctggctgcgggcc
cagcacttgcctgacggccttgacctggccgccctcaaggccgcagcccgagggctcttc
ctgctactgcgccactgggaccaaaacctgcagctacacctgctgtgctacagcccagcg
aacgtgtga

DBGET integrated database retrieval system