KEGG   Homo sapiens (human): 90134
Entry
90134             CDS       T01001                                 
Symbol
KCNH7, ERG3, HERG3, Kv11.3
Name
(RefSeq) potassium voltage-gated channel subfamily H member 7
  KO
K04910  potassium voltage-gated channel Eag-related subfamily H member 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    90134 (KCNH7)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   90134 (KCNH7)
SSDB
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS_3 PAS PAS_8 PAS_4 ATG16 Tmemb_cc2
Other DBs
NCBI-GeneID: 90134
NCBI-ProteinID: NP_150375
OMIM: 608169
HGNC: 18863
Ensembl: ENSG00000184611
Pharos: Q9NS40(Tclin)
UniProt: Q9NS40
Structure
Position
2:complement(162371407..162838767)
AA seq 1196 aa
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFGVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEVKTEKKNSSPPSSDKTIIA
PKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMNDSEGDNCKLRRRKLSFESE
GEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIG
KASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAAWGIS
ETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQKQTTVVPPAYSMVTAGSEY
QRPIIQLMRTSQPEASIKTDRSFSPSSQCPEFLDLEKSKLKSKESLSSGVHLNTASEDNL
TSLLKQDSDLSLELHLRQRKTYVHPIRHPSLPDSSLSTVGIVGLHRHVSDPGLPGK
NT seq 3591 nt   +upstreamnt  +downstreamnt
atgcctgtgcgcagggggcatgtggcaccacaaaatacatttctggggaccatcattcgg
aaatttgaagggcaaaataaaaaatttatcattgcaaatgccagagtgcagaactgtgcc
atcatttattgcaacgatgggttctgtgagatgactggtttctccaggccagatgtcatg
caaaagccatgcacctgcgactttctccatggacccgagaccaagaggcatgatattgcc
caaattgcccaggcattgctggggtcagaagagaggaaagtggaggtcacctactatcac
aaaaatgggtccacttttatttgtaacactcacataattccagtgaaaaaccaagagggc
gtggctatgatgttcatcattaattttgaatatgtgacggataatgaaaacgctgccacc
ccagagagggtaaacccaatattaccaatcaaaactgtaaaccggaaattttttgggttc
aaattccctggtctgagagttctcacttacagaaagcagtccttaccacaagaagacccc
gatgtggtggtcatcgattcatctaaacacagtgatgattcagtagccatgaagcatttt
aagtctcctacaaaagaaagctgcagcccctctgaagcagatgacacaaaagctttgata
cagcccagcaaatgttctcccttggtgaatatatccggacctcttgaccattcctctccc
aaaaggcaatgggaccgactctaccctgacatgctgcagtcaagttcccagctgtcccat
tccagatcaagggaaagcttatgtagtatacggagagcatcttcggtccatgatatagaa
ggattcggcgtccaccccaagaacatatttagagaccgacatgccagcgaagacaatggt
cgcaatgtcaaagggccttttaatcatatcaagtcaagcctcctgggatccacatcagat
tcaaacctcaacaaatacagcaccattaacaagattccacagctcactctgaatttttca
gaggtcaaaactgagaaaaagaattcatcacctccttcttcagataaaaccattattgca
cccaaggttaaagatcgaacacacaatgtgactgagaaagtgacccaggttctctcttta
ggagcagatgtcctacctgaatacaaactgcagacaccacgcatcaacaagtttacgata
ttgcactacagccctttcaaggcagtctgggactggcttatcctgctgttggtcatatac
actgctatatttactccctactctgcagccttcctcctcaatgacagagaagaacagaaa
agacgagaatgtggctattcttgtagccctttgaatgtggtagacttgattgtggatatt
atgtttatcatagatattttaataaacttcagaacaacatatgtaaatcagaatgaagaa
gtggtaagtgatcccgccaaaatagcaatacactacttcaaaggctggttcctgattgac
atggttgcagcaattccttttgacttgctgatttttggatcaggttctgatgagacaaca
acattaattggtcttttgaagactgcccgactcctccgtcttgtgcgcgtggccaggaaa
ctggatcgatattcagaatatggcgctgctgttctaatgctcttaatgtgcatctttgcc
ctgattgctcactggctggcttgcatttggtatgcgattgggaatgtagaaaggccttac
ctgactgacaaaatcggatggttggattccttaggacagcaaattgggaaacgttacaat
gacagtgactcaagttctggaccatccattaaagacaaatacgtcacagcactttatttt
accttcagcagtttaaccagtgtaggattcgggaatgtgtctcctaacacgaattcggag
aaaatcttttcaatttgtgtcatgttgattggctcactaatgtatgcaagcatttttggg
aatgtatctgcaattatccaaagactatactcgggaactgccaggtaccacatgcagatg
ctgcgagtaaaagagttcattcgctttcaccaaatccccaaccctctgaggcaacgtctt
gaagaatatttccagcacgcatggacttacaccaatggcattgacatgaacatggtccta
aagggtttcccagaatgcttacaagcagacatttgtctacatctcaaccagacattgctg
caaaactgcaaagcctttcggggggcaagtaaaggttgccttagagctttggcaatgaag
ttcaaaaccacccatgcacctccaggagacaccctcgttcactgtggggatgtcctcact
gcactttatttcttatccagaggctccattgaaattctcaaagatgacattgtggtggct
attctgggaaaaaatgatatatttggagaaatggttcatctttatgccaaacctggaaag
tctaatgcagatgtaagagccctcacatactgtgacttgcataagattcagcgagaagac
ttgttagaggttttggatatgtatcctgagttttctgatcactttctaacaaacctagag
ttgactttcaacctaaggcatgagagcgcaaaggctgatctcctacgatcacaatccatg
aatgattcagaaggagacaactgtaaactaagaagaaggaaattgtcatttgaaagtgaa
ggagagaaagaaaacagtacaaatgatcctgaagactctgcagataccataagacattat
cagagttccaagagacactttgaagagaaaaaaagcagatcctcatctttcatctcctcc
attgatgatgaacaaaagccgctcttctcaggaatagtagactcttctccaggaataggg
aaagcatctgggctcgattttgaagaaacagtgcccacctcaggaagaatgcacatagat
aaaagaagtcactcttgcaaagatatcactgacatgcgaagctgggaacgagaaaatgca
catccccagcctgaagactccagtccatctgcacttcagcgagctgcctggggtatctct
gaaaccgaaagcgacctcacctacggggaagtggaacaaagattagatctgctccaggag
caacttaacaggcttgaatcccaaatgaccactgacatccagaccatcttacagttgctg
cagaaacaaaccactgtggtccccccagcctacagtatggtaacagcaggatcagaatat
cagagacccatcatccagctgatgagaaccagtcaaccggaagcatccatcaaaactgac
cgaagtttcagcccttcctcacaatgtcctgaatttctagaccttgaaaaatctaaactt
aaatccaaagaatccctttcaagtggggtgcatctgaacacagcttcagaagacaacttg
acttcacttttaaaacaagacagtgatctctctttagagcttcacctgcggcaaagaaaa
acttacgttcatccaattaggcatccttctttgccagattcatccctaagcactgtagga
atcgtgggtcttcataggcatgtttctgatcctggtcttccagggaaataa

DBGET integrated database retrieval system