KEGG   Homo sapiens (human): 9015Help
Entry
9015              CDS       T01001                                 

Gene name
TAF1A, MGC:17061, RAFI48, SL1, TAFI48
Definition
(RefSeq) TATA-box binding protein associated factor, RNA polymerase I subunit A
  KO
K15212  TATA box-binding protein-associated factor RNA polymerase I subunit A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9015 (TAF1A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   Basal transcription factors
    SL1/TIF-1B
     9015 (TAF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAF1_subA DUF1967
Motif
Other DBs
NCBI-GeneID: 9015
NCBI-ProteinID: NP_001188465
OMIM: 604903
HGNC: 11532
Ensembl: ENSG00000143498
Vega: OTTHUMG00000037544
Pharos: Q15573(Tbio)
UniProt: Q15573 B4DS21 A8K4K5
Position
1q41
AA seq 450 aa AA seqDB search
MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSF
IQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNT
FANRMKNIGVMNYLKISLQHALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQ
AYKGLLQYYTWSEKKMELSKLDKDDYAYNAVAQDVFNHSWKTSANISALIKIPGVWDPFV
KSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLYNFLKRQKAPRSKLISVLKIL
YQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWKYLAKYLKNIL
MGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY
ILKQDHQILGKKIKRMKRSVKKYSIVNPRL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttcagtgaagaattaaaagggcctgtgacagatgatgaagaagtggaaaca
tctgtgctcagtggtgcaggaatgcattttccttggcttcaaacatacgtagaaactgtg
gccattggagggaaaaggaggaaggattttgctcagacaacaagtgcttgtttaagtttt
atccaagaagctctgctgaagcaccaatggcagcaagctgcagaatacatgtacagttat
tttcagaccttggaagattcagatagctacaaaaggcaggctgcacctgagattatttgg
aagctcggaagtgaaattctattttatcatcccaaaagcaacatggagagtttcaatact
tttgctaaccggatgaaaaatattggcgtcatgaattatttaaagatctccttacaacat
gcattataccttctgcatcatggaatgcttaaagatgctaagagaaatctgagtgaggca
gagacatggagacatggtgaaaatacgtcttcccgggaaatattaatcaaccttattcag
gcctataaagggcttttacagtattatacctggtctgaaaagaagatggaattgtcaaag
cttgataaggatgattatgcttacaatgcagtagcccaggatgtgttcaaccacagctgg
aagacatctgcaaatatttctgcattgattaaaattcctggagtttgggacccttttgtg
aagagttatgtagaaatgctggaattctatggggatcgagatggagcccaagaggtactc
accaattatgcatatgatgaaaagtttccatcaaatccaaatgcccatatctacttatac
aactttctaaagagacagaaggcaccaagatcaaaattgataagtgtgcttaagattttg
tatcagattgtaccatctcataaattgatgttggaattccatacattacttagaaaatca
gaaaaagaagaacaccgtaaactggggttggaggtattatttggagtcttagattttgcc
ggatgcactaagaatataactgcttggaaatacttggcaaaatatctgaaaaatatctta
atgggaaaccaccttgcgtgggttcaagaagagtggaactccaggaaaaactggtggcca
ggctttcatttcagctacttttgggcaaaaagtgattggaaggaagatacagctttggcc
tgtgagaaagcttttgtggctggtttactgttaggaaaaggttgtagatatttccggtat
attttaaagcaagatcaccaaatcttagggaagaaaattaagcggatgaagagatctgtg
aaaaaatacagtattgtaaatccaagactctga

DBGET integrated database retrieval system