KEGG   Homo sapiens (human): 9016
Entry
9016              CDS       T01001                                 

Gene name
SLC25A14, BMCP1, UCP5
Definition
(RefSeq) solute carrier family 25 member 14
  KO
K15106  solute carrier family 25 (mitochondrial carrier), member 14/30
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9016 (SLC25A14)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   9016 (SLC25A14)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 9016
NCBI-ProteinID: NP_001269124
OMIM: 300242
HGNC: 10984
Ensembl: ENSG00000102078
Vega: OTTHUMG00000022394
Pharos: O95258(Tbio)
UniProt: O95258
Position
Xq26.1
AA seq 325 aa
MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFP
VDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTI
KIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM
IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFV
SSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFW
PNWLRLGPWNIIFFITYEQLKRLQI
NT seq 978 nt   +upstreamnt  +downstreamnt
atgggtatctttcccggaataatcctaatttttctaagggtgaagtttgcaacggcggcc
gtgattgtaagcggacaccagaaaagtaccactgtaagtcatgagatgtctggtctgaat
tggaaaccctttgtatatggcggccttgcctctatcgtggctgagtttgggactttccct
gtggaccttaccaaaacacgacttcaggttcaaggccaaagcattgatgcccgtttcaaa
gagataaaatatagagggatgttccatgcgctgtttcgcatctgtaaagaggaaggtgta
ttggctctctattcaggaattgctcctgcgttgctaagacaagcatcatatggcaccatt
aaaattgggatttaccaaagcttgaagcgcttattcgtagaacgtttagaagatgaaact
cttttaattaatatgatctgtggggtagtgtcaggagtgatatcttccactatagccaat
cccaccgatgttctaaagattcgaatgcaggctcaaggaagcttgttccaagggagcatg
attggaagctttatcgatatataccaacaagaaggcaccaggggtctgtggaggggtgtg
gttccaactgctcagcgtgctgccatcgttgtaggagtagagctaccagtctatgatatt
actaagaagcatttaatattgtcaggaatgatgggcgatacaattttaactcacttcgtt
tccagctttacatgtggtttggctggggctctggcctccaacccggttgatgtggttcga
actcgcatgatgaaccagagggcaatcgtgggacatgtggatctctataagggcactgtt
gatggtattttaaagatgtggaaacatgagggcttttttgcactctataaaggattttgg
ccaaactggcttcggcttggaccctggaacatcattttttttattacatacgagcagcta
aagaggcttcaaatctaa

DBGET integrated database retrieval system