KEGG   Homo sapiens (human): 9019Help
Entry
9019              CDS       T01001                                 

Gene name
MPZL1, MPZL1b, PZR, PZR1b, PZRa, PZRb
Definition
(RefSeq) myelin protein zero like 1
  KO
K06770  myelin protein zero
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9019 (MPZL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    9019 (MPZL1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  P0
   9019 (MPZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 Adeno_E3_CR2 Trp_oprn_chp Rax2 Syndecan I-set EphA2_TM TMEM154 SIT FTR1
Motif
Other DBs
NCBI-GeneID: 9019
NCBI-ProteinID: NP_003944
OMIM: 604376
HGNC: 7226
Ensembl: ENSG00000197965
Vega: OTTHUMG00000034571
Pharos: O95297(Tbio)
UniProt: O95297 A8K5D4
Position
1q24.2
AA seq 269 aa AA seqDB search
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKF
KSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASI
NIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLT
LLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVI
YAQLDHSGGHHSDKINKSESVVYADIRKN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtccgccggagccggggcggtgattgcagccccagacagccggcgctggctg
tggtcggtgctggcggcggcgcttgggctcttgacagctggagtatcagccttggaagta
tatacgccaaaagaaatcttcgtggcaaatggtacacaagggaagctgacctgcaagttc
aagtctactagtacgactggcgggttgacctcagtctcctggagcttccagccagagggg
gccgacactactgtgtcgtttttccactactcccaagggcaagtgtaccttgggaattat
ccaccatttaaagacagaatcagctgggctggagaccttgacaagaaagatgcatcaatc
aacatagaaaatatgcagtttatacacaatggcacctatatctgtgatgtcaaaaaccct
cctgacatcgttgtccagcctggacacattaggctctatgtcgtagaaaaagagaatttg
cctgtgtttccagtttgggtagtggtgggcatagttactgctgtggtcctaggtctcact
ctgctcatcagcatgattctggctgtcctctatagaaggaaaaactctaaacgggattac
actggctgcagtacatcagagagtttgtcaccagttaagcaggctcctcggaagtccccc
tccgacactgagggtcttgtaaagagtctgccttctggatctcaccagggcccagtcata
tatgcacagttagaccactccggcggacatcacagtgacaagattaacaagtcagagtct
gtggtgtatgcggatatccgaaagaattaa

DBGET integrated database retrieval system