KEGG   Homo sapiens (human): 9020Help
Entry
9020              CDS       T01001                                 

Gene name
MAP3K14, FTDCR1B, HS, HSNIK, NIK
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    9020 (MAP3K14)
   04064 NF-kappa B signaling pathway
    9020 (MAP3K14)
   04668 TNF signaling pathway
    9020 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    9020 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    9020 (MAP3K14)
   04660 T cell receptor signaling pathway
    9020 (MAP3K14)
   04672 Intestinal immune network for IgA production
    9020 (MAP3K14)
  09158 Development
   04380 Osteoclast differentiation
    9020 (MAP3K14)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    9020 (MAP3K14)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    9020 (MAP3K14)
   05169 Epstein-Barr virus infection
    9020 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9020 (MAP3K14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     9020 (MAP3K14)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  Other
   9020 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 9020
NCBI-ProteinID: NP_003945
OMIM: 604655
HGNC: 6853
Ensembl: ENSG00000006062
Vega: OTTHUMG00000180364
Pharos: Q99558(Tchem)
UniProt: Q99558 Q68D39
Structure
PDB: 

Position
17q21.31
AA seq 947 aa AA seqDB search
MAVMEMACPGAPGSAVGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQE
DESPLGAPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHKLISPLQCLNHVW
KLHHPQDGGPLPLPTHPFPYSRLPHPFPFHPLQPWKPHPLESFLGKLACVDSQKPLPDPH
LSKLACVDSPKPLPGPHLEPSCLSRGAHEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTW
AARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDK
QTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQL
VKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVC
LQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFF
RGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGG
LKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPGPRPAEETTGRAPKLQPPLPPE
PPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARNPSSPERKATVPEQELQQLEIELFLN
SLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSS
SWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFS
LVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggtgcccctggctcagcagtggggcagcagaag
gaactccccaaagccaaggagaagacgccgccactggggaagaaacagagctccgtctac
aagcttgaggccgtggagaagagccctgtgttctgcggaaagtgggagatcctgaatgac
gtgattaccaagggcacagccaaggaaggctccgaggcagggccagctgccatctctatc
atcgcccaggctgagtgtgagaatagccaagagttcagccccaccttttcagaacgcatt
ttcatcgctgggtccaaacagtacagccagtccgagagtcttgatcagatccccaacaat
gtggcccatgctacagagggcaaaatggcccgtgtgtgttggaagggaaagcgtcgcagc
aaagcccggaagaaacggaagaagaagagctcaaagtccctggctcatgcaggagtggcc
ttggccaaacccctccccaggacccctgagcaggagagctgcaccatcccagtgcaggag
gatgagtctccactcggcgccccatatgttagaaacaccccgcagttcaccaagcctctg
aaggaaccaggccttgggcaactctgttttaagcagcttggcgagggcctacggccggct
ctgcctcgatcagaactccacaaactgatcagccccttgcaatgtctgaaccacgtgtgg
aaactgcaccacccccaggacggaggccccctgcccctgcccacgcaccccttcccctat
agcagactgcctcatcccttcccattccaccctctccagccctggaaacctcaccctctg
gagtccttcctgggcaaactggcctgtgtagacagccagaaacccttgcctgacccacac
ctgagcaaactggcctgtgtagacagtccaaagcccctgcctggcccacacctggagccc
agctgcctgtctcgtggtgcccatgagaagttttctgtggaggaatacctagtgcatgct
ctgcaaggcagcgtgagctcaggccaggcccacagcctgaccagcctggccaagacctgg
gcagcaaggggctccagatcccgggagcccagccccaaaactgaggacaacgagggtgtc
ctgctcactgagaaactcaagccagtggattatgagtaccgagaagaagtccactgggcc
acgcaccagctccgcctgggcagaggctccttcggagaggtgcacaggatggaggacaag
cagactggcttccagtgcgctgtcaaaaaggtgcggctggaagtatttcgggcagaggag
ctgatggcatgtgcaggattgacctcacccagaattgtccctttgtatggagctgtgaga
gaagggccttgggtcaacatcttcatggagctgctggaaggtggctccctgggccagctg
gtcaaggagcagggctgtctcccagaggaccgggccctgtactacctgggccaggccctg
gagggtctggaatacctccactcacgaaggattctgcatggggacgtcaaagctgacaac
gtgctcctgtccagcgatgggagccacgcagccctctgtgactttggccatgctgtgtgt
cttcaacctgatggcctgggaaagtccttgctcacaggggactacatccctggcacagag
acccacatggctccggaggtggtgctgggcaggagctgcgacgccaaggtggatgtctgg
agcagctgctgtatgatgctgcacatgctcaacggctgccacccctggactcagttcttc
cgagggccgctctgcctcaagattgccagcgagcctccgcctgtgagggagatcccaccc
tcctgcgcccctctcacagcccaggccatccaagaggggctgaggaaagagcccatccac
cgcgtgtctgcagcggagctgggagggaaggtgaaccgggcactacagcaagtgggaggt
ctgaagagcccttggaggggagaatataaagaaccaagacatccaccgccaaatcaagcc
aattaccaccagaccctccatgcccagccgagagagctttcgccaagggccccagggccc
cggccagctgaggagacaacaggcagagcccctaagctccagcctcctctcccaccagag
cccccagagccaaacaagtctcctcccttgactttgagcaaggaggagtctgggatgtgg
gaacccttacctctgtcctccctggagccagcccctgccagaaaccccagctcaccagag
cggaaagcaaccgtcccggagcaggaactgcagcagctggaaatagaattattcctcaac
agcctgtcccagccattttctctggaggagcaggagcaaattctctcgtgcctcagcatc
gacagcctctccctgtcggatgacagtgagaagaacccatcaaaggcctctcaaagctcg
cgggacaccctgagctcaggcgtacactcctggagcagccaggccgaggctcgaagctcc
agctggaacatggtgctggcccgggggcggcccaccgacaccccaagctatttcaatggt
gtgaaagtccaaatacagtctcttaatggtgaacacctgcacatccgggagttccaccgg
gtcaaagtgggagacatcgccactggcatcagcagccagatcccagctgcagccttcagc
ttggtcaccaaagacgggcagcctgttcgctacgacatggaggtgccagactcgggcatc
gacctgcagtgcacactggcccctgatggcagcttcgcctggagctggagggtcaagcat
ggccagctggagaacaggccctaa

DBGET integrated database retrieval system