KEGG   Homo sapiens (human): 9021Help
Entry
9021              CDS       T01001                                 

Gene name
SOCS3, ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04380  Osteoclast differentiation
hsa04630  Jak-STAT signaling pathway
hsa04668  TNF signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05168  Herpes simplex infection
Module
hsa_M00388  ECS complex
hsa_M00684  JAK-STAT signaling
Network
N00269  HCV Core to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9021 (SOCS3)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    9021 (SOCS3)
   04668 TNF signaling pathway
    9021 (SOCS3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    9021 (SOCS3)
   04920 Adipocytokine signaling pathway
    9021 (SOCS3)
   04917 Prolactin signaling pathway
    9021 (SOCS3)
  Development
   04380 Osteoclast differentiation
    9021 (SOCS3)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    9021 (SOCS3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9021 (SOCS3)
   04931 Insulin resistance
    9021 (SOCS3)
  Infectious diseases
   05164 Influenza A
    9021 (SOCS3)
   05160 Hepatitis C
    9021 (SOCS3)
   05168 Herpes simplex infection
    9021 (SOCS3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     9021 (SOCS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 9021
NCBI-ProteinID: NP_003946
OMIM: 604176
HGNC: 19391
Ensembl: ENSG00000184557
Vega: OTTHUMG00000177513
Pharos: O14543(Tbio)
UniProt: O14543 Q6FI39
Position
17q25.3
AA seq 225 aa AA seqDB search
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agtgccgagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctgggagtccc
cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

DBGET integrated database retrieval system