KEGG   Homo sapiens (human): 9022
Entry
9022              CDS       T01001                                 

Symbol
CLIC3
Name
(RefSeq) chloride intracellular channel 3
  KO
K05023  chloride intracellular channel protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    9022 (CLIC3)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   9022 (CLIC3)
SSDB
Motif
Pfam: GST_C_2 GST_N_3 GST_N_2 GST_C GST_C_3
Other DBs
NCBI-GeneID: 9022
NCBI-ProteinID: NP_004660
OMIM: 606533
HGNC: 2064
Ensembl: ENSG00000169583
Vega: OTTHUMG00000020954
Pharos: O95833(Tbio)
UniProt: O95833
Structure
PDB: 
3KJY 3FY7

Position
9q34.3
AA seq 236 aa
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS
QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPV
PAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKL
HIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcggagaccaagctccagctgtttgtcaaggcgagtgaggacggggagagcgtgggt
cactgcccctcctgccagcggctcttcatggtcctgctcctcaagggcgtacctttcacc
ctcaccacggtggacacgcgcaggtccccggacgtgctgaaggacttcgcccccggctcg
cagctgcccatcctgctctatgacagcgacgccaagacagacacgctgcagatcgaggac
tttctggaggagacgctggggccgcccgacttccccagcctggcgcctcgttacagggag
tccaacaccgccggcaacgacgttttccacaagttctccgcgttcatcaagaacccggtg
cccgcgcaggacgaagccctgtaccagcagctgctgcgcgccctcgccaggctggacagc
tacctgcgcgcgcccctggagcacgagctggcgggggagccgcagctgcgcgagtcccgc
cgccgcttcctggacggcgacaggctcacgctggccgactgcagcctcctgcccaagctg
cacatcgtcgacacggtgtgcgcgcacttccgccaggcgcccatccccgcggagctgcgc
ggcgtacgccgctacctggacagcgcgatgcaggagaaagagttcaaatacacgtgtccg
cacagcgccgagatcctggcggcctaccggcccgccgtgcacccccgctag

DBGET integrated database retrieval system