KEGG   Homo sapiens (human): 9024
Entry
9024              CDS       T01001                                 

Gene name
BRSK2, C11orf7, PEN11B, SAD1, SADA, STK29
Definition
(RefSeq) BR serine/threonine kinase 2
  KO
K08796  BR serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9024 (BRSK2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9024 (BRSK2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9024 (BRSK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9024 (BRSK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   9024 (BRSK2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    9024 (BRSK2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     9024 (BRSK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Choline_kinase Kdo
Other DBs
NCBI-GeneID: 9024
NCBI-ProteinID: NP_001243556
OMIM: 609236
HGNC: 11405
Ensembl: ENSG00000174672
Vega: OTTHUMG00000167089
Pharos: Q8IWQ3(Tchem)
UniProt: Q8IWQ3
Position
11p15.5
AA seq 736 aa
MTSTGKDGGAQHAQYVGPYRLEKTLGKGQTGLVKLGVHCVTCQKVAIKIVNREKLSESVL
MKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARK
FFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPH
YACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIP
PDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRKVQIRSLPSLEDIDP
DVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDP
PRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQHGQRSRSISGASSGL
STSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPWRARLN
SIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKD
KPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGE
AQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSDTTNCMEMMTGRLS
KCGSPLSNFFDVIKQLFSDEKNGQAAQAPSTPAKRSAHGPLGDSAAAGPGPGGDAEYPTG
KDTAKMGPPTARREQP
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgacatcgacggggaaggacggcggcgcgcagcacgcgcagtatgttgggccctaccgg
ctggagaagacgctgggcaaggggcagacaggtctggtgaagctgggggttcactgcgtc
acctgccagaaggtggccatcaagatcgtcaaccgtgagaagctcagcgagtcggtgctg
atgaaggtggagcgggagatcgcgatcctgaagctcattgagcacccccacgtcctaaag
ctgcacgacgtttatgaaaacaaaaaatatttgtacctggtgctagaacacgtgtcaggt
ggtgagctcttcgactacctggtgaagaaggggaggctgacgcctaaggaggctcggaag
ttcttccggcagatcatctctgcgctggacttctgccacagccactccatatgccacagg
gatctgaaacctgaaaacctcctgctggacgagaagaacaacatccgcatcgcagacttt
ggcatggcgtccctgcaggttggcgacagcctgttggagaccagctgtgggtccccccac
tacgcctgccccgaggtgatccggggggagaagtatgacggccggaaggcggacgtgtgg
agctgcggcgtcatcctgttcgccttgctggtgggggctctgcccttcgacgatgacaac
ttgcgacagctgctggagaaggtgaagcggggcgtgttccacatgccgcactttatcccg
cccgactgccagagtctgctacggggcatgatcgaggtggacgccgcacgccgcctcacg
ctagagcacattcagaaacacatatggtatatagggggcaagaatgagcccgaaccagag
cagcccattcctcgcaaggtgcagatccgctcgctgcccagcctggaggacatcgacccc
gacgtgctggacagcatgcactcactgggctgcttccgagaccgcaacaagctgctgcag
gacctgctgtccgaggaggagaaccaggagaagatgatttacttcctcctcctggaccgg
aaagaaaggtacccgagccaggaggatgaggacctgcccccccggaacgagatagaccct
ccccggaagcgtgtggactccccgatgctgaaccggcacggcaagcggcggccagaacgc
aaatccatggaggtgctcagcgtgacggacggcggctccccggtgcctgcgcggcgggcc
attgagatggcccagcacggccagaggtctcggtccatcagcggtgcctcctcaggcctt
tccaccagcccactcagcagcccccgggtgacccctcacccctcaccaaggggcagtccc
ctccccacccccaaggggacacctgtccacacgccaaaggagagcccggctggcacgccc
aaccccacgcccccgtccagccccagcgtcggaggggtgccctggagggcgcggctcaac
tccatcaagaacagctttctgggctcaccccgcttccaccgccggaaactgcaagttccg
acgccggaggagatgtccaacctgacaccagagtcgtccccagagctggcgaagaagtcc
tggtttgggaacttcatcagcctggagaaggaggagcagatcttcgtggtcatcaaagac
aaacctctgagctccatcaaggctgacatcgtgcacgccttcctgtcgattcccagtctc
agccacagcgtcatctcccaaacgagcttccgggccgagtacaaggccacgggggggcca
gccgtgttccagaagccggtcaagttccaggttgatatcacctacacggagggtggggag
gcgcagaaggagaacggcatctactccgtcaccttcaccctgctctcaggccccagccgt
cgcttcaagagggtggtggagaccatccaggcccagctgctgagcacacacgacccgcct
gcggcccagcacttgtcagacaccactaactgtatggaaatgatgacggggcggctttcc
aaatgtggcagcccattgagtaacttctttgacgtaattaaacaacttttttcagacgag
aagaacgggcaggcggcccaggcccccagcacgcccgccaagcggagtgcccacggccca
ctcggtgactccgcggccgctggccctggccccggaggggacgccgagtacccaacgggc
aaggacacggccaagatgggcccgcccaccgcccgccgcgagcagccttag

DBGET integrated database retrieval system