KEGG   Homo sapiens (human): 9031Help
Entry
9031              CDS       T01001                                 

Gene name
BAZ1B, WBSCR10, WBSCR9, WSTF
Definition
(RefSeq) bromodomain adjacent to zinc finger domain 1B
  KO
K11658  bromodomain adjacent to zinc finger domain protein 1B
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9031 (BAZ1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   WICH complex
    9031 (BAZ1B)
   B-WICH complex
    9031 (BAZ1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WAC_Acf1_DNA_bd WSD Bromodomain PHD WHIM1 DDT zf-HC5HC2H zf-ANAPC11 PHD_2 zf-RING_2 C1_2
Motif
Other DBs
NCBI-GeneID: 9031
NCBI-ProteinID: NP_115784
OMIM: 605681
HGNC: 961
Ensembl: ENSG00000009954
Vega: OTTHUMG00000023847
Pharos: Q9UIG0(Tbio)
UniProt: Q9UIG0
Structure
PDB: 

Position
7q11.23
AA seq 1483 aa AA seqDB search
MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQL
THKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEEC
DFEVGKEKMLKVKIVKIHPLEKVDEEATEKKSDGACDSPSSDKENSSQIAQDHQKKETVV
KEDEGRRESINDRARRSPRKLPTSLKKGERKWAPPKFLPHKYDVKLQNEDKIISNVPADS
LIRTERPPNKEIVRYFIRHNALRAGTGENAPWVVEDELVKKYSLPSKFSDFLLDPYKYMT
LNPSTKRKNTGSPDRKPSKKSKTDNSSLSSPLNPKLWCHVHLKKSLSGSPLKVKNSKNSK
SPEEHLEEMMKMMSPNKLHTNFHIPKKGPPAKKPGKHSDKPLKAKGRSKGILNGQKSTGN
SKSPKKGLKTPKTKMKQMTLLDMAKGTQKMTRAPRNSGGTPRTSSKPHKHLPPAALHLIA
YYKENKDREDKRSALSCVISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSE
EQRKEYLKKKREELKKKLKEKAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPE
GLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQ
TLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLRRSDVQEESEGSDTDDNKDSAAFE
DNEVQDEFLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKER
LAVLKEENDKKRAEKQKRKEMEAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMIS
AVKSRRLLAIQAKKEREIQEREMKVKLERQAEEERIRKHKAAAEKAFQEGIAKAKLVMRR
TPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDEDYCPRSKKAN
LGKNASMNTQHGTATEVAVETTTPKQGQNLWFLCDSQKELDELLNCLHPQGIRESQLKER
LEKRYQDIIHSIHLARKPNLGLKSCDGNQELLNFLRSDLIEVATRLQKGGLGYVEETSEF
EARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRRKLQSEDSAKTEEVDEEKKMV
EEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLI
LCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNSRGRNYTEESASEDSEDDESD
EEEEEEEEEEEEEDYEVAGLRLRPRKTIRGKHSVIPPAARSGRRPGKKPHSTRRSQPKAP
PVDDAEVDELVLQTKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVI
THPMDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALL
HKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK
NT seq 4452 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgctcctgggccgcaagcccttcccgctggtgaagccgttgcccggagaggag
ccgctcttcaccatcccgcacactcaggaggccttccgcacccgggaagagtatgaagcc
cgcttggaaaggtacagtgagcgcatttggacgtgcaagagtactggaagcagtcagcta
acacacaaggaagcctgggaggaagaacaggaagttgctgagcttttgaaggaggagttt
cctgcctggtatgagaagcttgttctggaaatggttcaccataacacagcctccttagag
aagttagtagatactgcttggttggagatcatgaccaaatatgctgtgggagaagagtgt
gacttcgaggttgggaaggagaaaatgctcaaggtgaagattgtgaagattcatcctttg
gagaaagtggatgaagaggccactgagaagaaatctgatggtgcctgtgattctccatca
agtgacaaagagaactccagtcagattgctcaggaccatcagaagaaggagacagttgtg
aaagaggatgaaggaaggagagagagtattaatgacagagcacgtagatcgccacgaaaa
cttcctacttcattaaaaaaaggagaaaggaaatgggctcctccaaaatttctgcctcac
aaatatgatgtgaaactacaaaatgaagataagatcatcagtaacgtgccagcagacagc
ttgattcgtacagagcgcccaccaaataaggagatagttcgatactttatacggcataat
gcattacgagctggtactggtgaaaatgcaccttgggtcgtagaagatgaattggtgaag
aaatactctctgcccagcaagttcagtgactttttacttgatccatacaagtatatgact
ctcaacccttctactaagaggaagaatactggatccccagacaggaagccctcaaagaaa
tccaagacagacaactcttctcttagttcaccactaaatcctaagttatggtgtcacgta
cacttgaagaagtcattgagtggctcgccactcaaagtgaagaactcaaagaattccaaa
tctcctgaagaacatctagaagaaatgatgaagatgatgtcgcccaataagctgcacact
aactttcacattcctaaaaaaggcccacctgccaagaaaccagggaagcacagtgacaag
cctttgaaggcaaagggcagaagcaaaggcatcctgaatggacagaaatccacagggaat
tccaaatctcccaaaaaaggactgaagactcctaaaaccaaaatgaagcagatgactttg
ttggatatggccaaaggcacgcagaagatgacacgagccccacggaattctgggggtaca
cctaggacctctagtaaacctcataaacatctgcctcctgcagccctacacctcattgca
tactacaaagaaaacaaagacagggaggacaagaggagcgccctgtcctgtgttatctcc
aaaacagctcgtcttctctctagtgaagatagagctcgtctcccagaagaattgcgaagt
cttgttcaaaaacgctatgaacttctagagcacaaaaagaggtgggcttctatgtctgaa
gaacaacggaaagaatatttgaaaaagaaacgggaggagctgaaaaagaagttgaaggaa
aaagccaaagaacgaagagagaaagaaatgcttgagagattagaaaaacagaagcggtat
gaggaccaagagttaactggcaaaaaccttccagcattcagattggtggatacccctgaa
gggctgcccaacacgctgtttggggatgtggccatggtggtggaattcttgagctgttat
tctgggctacttttaccagatgctcagtatcctattactgctgtgtcccttatggaagcc
ttgagtgcagataagggtggctttttataccttaacagggtgttggtcatcctcttacag
accctcctacaagatgagatagcagaagactatggtgaattgggaatgaagctgtcggaa
atccccttgactctgcattctgtttcagagctggtgcggctctgcttgcgcagatctgat
gttcaggaggaaagcgagggctcagacacagatgacaataaagattcagctgcatttgag
gataatgaggtacaagatgagttcctagaaaagctggagacctctgaattttttgagctg
acgtcagaggagaagctacagatcttgacagcactgtgccaccggatcctcatgacatac
tcagtgcaagaccacatggagaccagacagcagatgtctgcagagttgtggaaggaacgg
cttgctgtgttgaaggaagaaaatgataagaagagagcagagaaacagaaacggaaagaa
atggaagccaaaaataaagaaaatggaaaagttgagaatgggttaggcaaaactgatagg
aaaaaagaaattgtgaagtttgagccccaagtagatacagaagctgaagacatgattagt
gctgtgaagagcagaaggttgcttgccattcaagctaagaaggaacgggaaatccaggaa
agagaaatgaaagtgaaactggaacgccaagctgaagaagaacgaatacggaagcacaaa
gcagctgctgagaaagctttccaggaagggattgccaaggccaaactagtcatgcgcagg
actcctattggcacagatcgaaaccataatagatactggctcttctcagatgaagttcca
ggattattcattgaaaaaggctgggtacatgacagcattgactaccgattcaaccatcac
tgcaaagaccacacagtctctggtgatgaggattactgtcctcgcagtaagaaagcaaac
ttaggtaaaaatgcaagcatgaacacacaacatggaacagcaacagaagttgctgtagag
acaaccacacccaaacaaggacagaacctatggtttttatgtgatagtcaaaaggagctg
gatgagttgctaaactgtcttcaccctcagggaataagagaaagtcaacttaaagagaga
ctagagaagaggtaccaggacattattcactctattcatctagcacggaagccaaatttg
ggtctaaaatcttgtgatggcaaccaggagcttttaaacttccttcgtagtgatctcatt
gaagttgcaacaaggttacaaaaaggaggacttggatatgtggaagaaacatcagaattt
gaagcccgggtcatttcattagagaaattgaaggattttggtgagtgtgtgattgccctt
caggccagtgtcataaagaaatttctccaaggcttcatggctcccaagcaaaagagaaga
aaactccaaagtgaagattcagcaaaaactgaggaagtggatgaagagaagaaaatggta
gaggaagcaaaggttgcatctgcactggagaaatggaagacagcaatccgggaagctcag
actttctccaggatgcacgtgctgcttgggatgcttgatgcctgtatcaagtgggatatg
tccgcagaaaatgctaggtgcaaagtttgtcgaaagaaaggtgaggatgacaaattgatc
ttgtgtgatgagtgtaataaagccttccacctgttttgtctgaggccggccctctatgaa
gtaccagatggtgagtggcagtgcccagcttgccagcccgctactgccaggcgcaactcc
cgtggcaggaactatactgaagagtctgcttctgaggacagtgaagatgatgagagtgat
gaagaggaggaggaggaagaagaggaggaggaggaagaagattatgaggtggctggtttg
cgattgagacctcgaaagaccatccggggcaagcacagcgtcatcccccctgcagcaagg
tcaggccggcgcccgggtaagaagccacactctaccaggaggtctcagcccaaggcacca
cctgtggatgatgctgaggtggatgagctggtgcttcagaccaagcggagctcccggagg
caaagcctggagctgcagaagtgtgaagagatcctccacaagatcgtgaagtaccgcttc
agctggcccttcagggagcctgtgaccagagatgaggccgaggactactatgatgtgatc
acgcaccccatggactttcagacagtgcagaacaaatgttcctgtgggagctaccgctct
gtgcaggagtttcttactgacatgaagcaagtgtttaccaatgctgaggtttacaactgc
cgtggcagccatgtgctaagctgcatggtgaagacagaacagtgtctagtggctctgttg
cataaacaccttcctggccacccatatgtccgcaggaagcgcaagaagtttcctgatagg
cttgctgaagatgaaggggacagtgagccagaggccgttggacagtccaggggacgaaga
cagaagaagtag

DBGET integrated database retrieval system