KEGG   Homo sapiens (human): 90324
Entry
90324             CDS       T01001                                 
Symbol
CCDC97
Name
(RefSeq) coiled-coil domain containing 97
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CCD97-like_C RPA43_OB
Other DBs
NCBI-GeneID: 90324
NCBI-ProteinID: NP_443080
HGNC: 28289
Ensembl: ENSG00000142039
Pharos: Q96F63(Tdark)
UniProt: Q96F63
Position
19:41310172..41324873
AA seq 343 aa
MEAVATATAAKEPDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSGAEN
AAVSAMLHAVAASRLPVCSQQQGEPDLTEHEKVAILAQLYHEKPLVFLERFRTGLREEHL
ACFGHVRGDHRADFYCAEVARQGTARPRTLRTRLRNRRYAALRELIQGGEYFSDEQMRFR
APLLYEQYIGQYLTQEELSARTPTHQPPKPGSPGRPACPLSNLLLQSYEERELQQRLLQQ
QEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGD
FDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggaggccgtggcgacggcgacggcggcgaaggaacccgataagggctgcatagagcct
ggacctgggcactggggtgagctgagccggacaccagtcccatctaaaccccaggacaaa
gtggaagcagctgaggcaacaccagtggccctggacagtgacacctccggggctgaaaat
gcagcagtgagtgctatgctgcacgctgtagccgccagccgcctgcctgtttgcagccag
cagcagggtgaacccgacttgacagagcatgagaaagtggccatcctggcccagctgtac
cacgagaagccactggtgttcctggagcgcttccgcacaggcctccgtgaggagcatctg
gcctgctttggccacgtgcgtggcgaccaccgtgcagacttctactgtgctgaggtggcc
cggcagggcactgcccggccccgcaccctgcgtacccgcctgcgtaaccggcgctatgct
gccctgcgagagctgatccaagggggcgagtacttcagtgatgagcagatgcggttccgg
gcccccctgctatatgagcagtacatcgggcagtatctcacccaggaggagctcagtgcc
cgcaccccaacccaccagccccccaagcccgggtcccccgggagacctgcttgcccgctc
tccaacttgctgctccagtcctacgaggagcgggagctacagcagcgtctgctccaacag
caggaggaggaggaggcctgcttggaggaagaggaagaggaggaggacagtgacgaggaa
gaccagaggtcaggcaaggactcggaggcctgggttcccgactcggaggagaggctgatc
ctgcgagaggagttcaccagccgcatgcaccagcgcttcctagatggcaaggacggggac
tttgactacagcacagtagacgacaaccccgacttcgacaacctcgacatcgtggcacgg
gatgaggaggagaggtactttgatgaggaagaacctgaggatgcgcccagcccagagctg
gatggggactga

DBGET integrated database retrieval system