KEGG   Homo sapiens (human): 90332
Entry
90332             CDS       T01001                                 

Gene name
EXOC3L2, XTP7
Definition
(RefSeq) exocyst complex component 3 like 2
  KO
K19988  exocyst complex component 3-like protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    90332 (EXOC3L2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    90332 (EXOC3L2)
SSDB
Motif
Pfam: Sec6
Other DBs
NCBI-GeneID: 90332
NCBI-ProteinID: NP_001369351
OMIM: 616927
HGNC: 30162
Ensembl: ENSG00000283632
Pharos: Q2M3D2(Tbio)
Position
19q13.32
AA seq 802 aa
MPILKNLGVSDPKVPRAGTLPLRSSRNPFEEVSGLEEEEAGELGSLPNGTSCRRRATLEK
LAGLAPFRLGWAPGRRAGSPGDGQPRSFLGRVLVPGIRRSSADFGLLARLHGTRAHGDEE
AAGEAARRLAFLRLGRGSKPQRASLAERVVPAGEAAPEPPPKVPEPPKMKEPLSVLEILS
LIQQRELARADEHILELEAEELAPSRGGAPGPPKAEGAGGGRRARDVALLYEALQRELWA
LVRETLAGPGPGACAGAGAVAQLGQVLVQEEAADGRRGPGAARKLRARWAEAVARAARER
LEAAAPGAPGGLAGQLEALRARLLEDMAVVRGRLAPAYPAGLGAFGVYLRGYHGALAEWL
GASARRRLPLADRYALLHWHNQVYPREVLGLVDMAALENGELGPLLSPGTLRGLEDECVT
DVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQDVCELLEEHTERAPRISQEFGERMAHC
CLGGLAEFLQSFQQRVERFHENPAVREMLPDTYISKTIALVNCGPPLRALAERLARVGPP
ESEPAREASASALDHVTRLCHRVVANLLFQELQPHFNKLMRRKWLSSPEALDGIVGTLGA
QALALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRVAGRLREDAAQLQ
RLFRRLESQASWLDAVVPHLAEVMQLEDTPSIQVEVGVLVRDYPDIRQKHVAALLDIRGL
RNTAARQEILAVARDLELSEEGALSPPRDRAFFADIPVPRPSFCLSLPLFLGRLPLSRLA
RPSLACLPRPRPPSLARPRAQR
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgcctatcctgaagaatctgggagtgtcagaccctaaggtgccccgggcggggaccctg
cccctgaggtcctctcggaacccctttgaagaagtttcagggctggaggaagaagaggcc
ggggagctggggtccctccccaatggaacatcttgtcgccgccgcgccaccctggagaag
cttgcgggcctggcccccttccggctgggctgggccccgggccggcgggcaggcagccct
ggggatgggcagccccgctctttcttgggccgtgtgctggtaccagggatacgcaggagc
tcagcagattttggcctcctggcccggctgcatgggacccgagcccacggcgacgaggag
gcagcgggggaggccgcccggagactggccttcctgagactggggcgtggatccaagccc
cagcgtgcgtccctggctgagagagtggtgcctgcaggcgaggcagctccagagccccca
cccaaggtcccagagcccccaaagatgaaggagccattgtcagtgctggagatcctgagc
ctgatccagcagcgcgaactagcgcgtgcggacgagcacatcctggagctagaggccgag
gagctggcgccgtcgaggggcggcgcgcctgggcctcccaaggccgagggcgctggcggg
ggccgccgggcgcgggacgtggcgctgctgtacgaggccctgcagcgcgagctgtgggcg
ctggtgcgcgagacgctggcgggccccgggccgggagcgtgcgccggggctggcgcggtg
gcgcagctgggccaggtgctggtacaggaggaggcggccgacgggcgtcggggtcccggg
gcggcccgcaaactacgcgcacgctgggccgaagccgtggcgcgcgcggcccgggagcgc
ctagaggcagcggctcccggggcgcccgggggcctggccgggcagctggaggcgctgcgg
gcgcggctgctggaggatatggccgtggtgcggggccgcctggcgcccgcctaccccgcc
ggcctgggcgccttcggcgtctacctgcgcggctaccacggggccctggccgagtggctg
ggggcctccgcccgtcgcaggctgccgctggccgaccgctacgcgctgctgcactggcac
aatcaggtctaccccagagaggtcctagggctggtggacatggccgccctggagaatggg
gagctggggccccttctctcccctggcaccctgcggggtttggaggatgaatgcgtcaca
gatgttaaggctcagacccgggctgcccttctccgtgtgctgcaggaggacgaagagcac
tgggggagcctggaggaccagcccagcagcctggcccaggatgtgtgtgagctgctggaa
gagcacacagagcgagcaccccgcatcagccaggagtttggggagcggatggcccactgc
tgcctaggcgggctggcagagttcctgcagagcttccagcagcgtgtggagcgattccat
gagaacccagcagtccgggagatgctacctgacacctatatcagcaagaccatcgccctg
gtcaactgcggccccccactgagagctctggccgagcgcctggcccgggtggggccccca
gaaagcgagccggcccgggaagcatctgctagtgctctggaccatgtgacccggctctgc
caccgtgtcgtggccaacctgctgttccaggagctgcagccacacttcaacaagctgatg
cgccggaagtggctgagcagcccggaggccctggatggcatcgtgggcacgctgggtgcc
caggccctggccctgcgcagaatgcaggacgagccttaccaggcgctggtagccgagcta
caccggcgggcgctggtcgagtacgtgcggcccctgctccgtgggcgcctgcgctgcagc
tcggcgcggacccgcagccgcgtggccggcaggctccgggaggacgcggcgcaactgcag
aggctgttccggcggctggagtcccaggcctcgtggctggatgccgtggtgccccatttg
gctgaagtcatgcagctggaagacacgcccagcatccaggtggaggtgggagtgttggtg
cgcgactacccagacatcaggcagaagcacgtggcagccctcctcgacatccgtggcctg
cgcaacacagccgcccgccaggagatcctggccgtggcccgggacctggaactctctgag
gagggagccctgtcaccccctcgggaccgtgccttctttgcagacatccctgtgccccgc
ccatctttctgtctcagcctccctctcttcctgggccgcctccccctctcccggctggcc
aggcccagtttggcctgtctgcctcggccccggcctccgtctctagcgcgacctcgggcc
cagcgctga

DBGET integrated database retrieval system