KEGG   Homo sapiens (human): 9037Help
Entry
9037              CDS       T01001                                 

Gene name
SEMA5A, SEMAF, semF
Definition
(RefSeq) semaphorin 5A
  KO
K06841  semaphorin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00764  Chromosme 5p deletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    9037 (SEMA5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema TSP_1
Motif
Other DBs
NCBI-GeneID: 9037
NCBI-ProteinID: NP_003957
OMIM: 609297
HGNC: 10736
Ensembl: ENSG00000112902
Vega: OTTHUMG00000090501
Pharos: Q13591(Tbio)
UniProt: Q13591 X5DR95
Position
5p15.31
AA seq 1074 aa AA seqDB search
MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY
AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
DLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPNPNPHFQCGTV
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII
YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVV
KIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVD
GHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
PWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS
EWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaacctgtgttatagcatggctgttctcaagcctggggctgtggagactcgcc
cacccagaggcccagggtacgactcagtgccagagaaccgagcatccagtcatctcctat
aaagaaattggcccctggttacgggagttcagagcgaagaatgctgtggatttctcgcag
ttaacatttgacccaggacagaaagaacttgttgtaggagcaagaaactacctcttcagg
ttacagcttgaggatctgtctcttatccaggctgtggaatgggagtgtgatgaagctacc
aaaaaggcctgttacagcaaaggcaaatcaaaggaggaatgtcagaactacatccgggtg
cttctggtgggtggcgaccggttattcacctgtgggaccaatgcattcacgcctgtctgc
accaaccgctcgttgagcaacctgactgagatccatgatcagatcagtggcatggcccgc
tgtccctacagtccccagcacaattccacagcgctcctcacagctggtggggagctctat
gctgctacagccatggattttccaggacgtgatcctgccatttaccgaagcctaggcatt
ttacctcctctccgcacggcgcagtacaactccaaatggctcaatgagccaaactttgtg
tcatcttatgacatcggaaattttacctacttctttttccgagaaaatgcagtagagcat
gactgtgggaaaacagtgttctccagagctgcccgggtgtgcaagaacgatattggtggg
cgcttcctgctggaagacacctggaccacattcatgaaggctcgcctgaactgctcccgt
cctggggaagtccccttttactacaacgaattgcagagtactttcttcctgcctgagctg
gatttgatctatggcatctttaccaccaatgtgaacagcattgcggcctcagctgtgtgc
gtcttcaacctgagcgccatcgcgcaggccttctctgggcccttcaagtaccaagaaaac
tcgcgctcggcctggctaccgtatcccaacccaaacccccacttccagtgtggcaccgtg
gaccagggcctgtacgtgaacctgaccgagagaaatctgcaggatgctcagaagttcatt
ctgatgcatgaggtggtacagccagtgaccacagtgccctccttcatggaggacaatagc
cgcttttcccacgtggcagtcgacgtggtgcagggcagagaagcgctcgtccacatcatc
tatttggccacagattacggaaccattaagaaagtgcgggtacccctgaatcagacctca
agcagctgtttgctggaagagattgagctcttccctgagaggcggagggagcccatcagg
agcctgcagatcctgcacagccagagtgtcctgttcgtgggcctgcgggagcacgtggtc
aagatccccctgaagaggtgccagttctaccgcacacgcagcacctgcattggggcccag
gacccttactgtggctgggatgtggtaatgaagaaatgcacaagcctggaggagagcctg
agcatgacgcagtgggaacagagcatctctgcgtgtccgaccaggaatctcaccgtggat
gggcactttggtgtgtggtctccgtggacgccttgcacgcacacagatggcagcgccgtg
ggatcctgcctctgtcgaacccgctcctgcgacagcccggccccgcagtgtggtggctgg
cagtgcgagggccctggcatggagatcgccaactgttccaggaacggaggctggactccc
tggacctcgtggtctccctgcagcactacctgtgggatcggcttccaggtgcggcagcgc
tcctgcagcaaccccactcccaggcacgggggccgggtgtgcgtgggacagaaccgcgag
gaaagatactgcaatgaacatttgctatgtcccccacacatgttctggacaggctggggt
ccttgggaacggtgcacagcccaatgcgggggtggcattcaagctcgccgcaggatctgt
gagaatgggcctgactgtgcaggctgcaatgtggagtaccagtcttgcaacaccaacccg
tgtcctgagctgaagaagaccacgccctggacaccctggacacctgtcaacatctctgac
aacggcggccactatgagcaacgattccgatacacatgcaaagcccgcctggctgatccg
aatttgctggaagtgggaagacagagaatcgaaatgcggtactgttctagcgacggcacc
agtggctgctccacagatgggctttctggggatttcctgcgtgctgggagatactctgcc
cacacggtcaacggggcttggtcagcctggacgtcgtggtcacagtgcagccgtgactgc
agcaggggcattcggaaccggaagcgtgtttgcaacaaccccgaacccaagtatggggga
atgccttgccttggcccatctctggaataccaggaatgcaacattttgccctgcccagtg
gatggcgtgtggtcttgctggtccccctggacaaaatgttcagcaacatgcggcggtgga
cactatatgaggacccgctcttgctccaatccagccccggcctatggaggggacatctgc
ctggggctgcacacagaagaggcactctgcaacacgcagccctgcccagagagctggtcg
gagtggtcggactggtctgagtgtgaagcctctggcgtccaagtccgcgcccgccagtgc
atcctcctgttccccatgggcagccagtgctccgggaacaccacggagagccggccgtgt
gtgtttgactctaatttcatcccagaagtatctgtggcaagatccagtagcgtagaagag
aaaaggtgtggagagttcaacatgttccacatgatcgccgtggggctgagcagctccatc
ctcggctgcctcctcaccctgctcgtctatacttactgccagcggtaccagcagcaatcc
cacgatgcgactgtcatccaccccgtctcacctgccccccttaataccagcataaccaac
cacatcaacaaactggacaagtacgactcggtggaggccatcaaggcatttaacaaaaac
aacttgatcctagaggaaagaaacaaatacttcaacccacatctcactgggaagacctat
tctaatgcctactttacagatctcaataattatgatgagtactaa

DBGET integrated database retrieval system