KEGG   Homo sapiens (human): 9038Help
Entry
9038              CDS       T01001                                 

Gene name
TAAR5, PNR
Definition
(RefSeq) trace amine associated receptor 5
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9038 (TAAR5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Trace amine
    9038 (TAAR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 9038
NCBI-ProteinID: NP_003958
OMIM: 607405
HGNC: 30236
Ensembl: ENSG00000135569
Vega: OTTHUMG00000015581
Pharos: O14804(Tbio)
UniProt: O14804
Position
6q23.2
AA seq 337 aa AA seqDB search
MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVS
YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT
SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS
QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL
AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC
NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtcttcatccaaggtgctgaagagcaccctgcggcattctgctaccaggtg
aatgggtcttgccccaggacagtacatactctgggcatccagttggtcatctacctggcc
tgtgcagcaggcatgctgattatcgtgctagggaatgtatttgtggcatttgctgtgtcc
tacttcaaagcgcttcacacgcccaccaacttcctgctgctctccctggccctggctgac
atgtttctgggtctgctggtgctgcccctcagcaccattcgctcagtggagagctgctgg
ttcttcggggacttcctctgccgcctgcacacctacctggacaccctcttctgcctcacc
tccatcttccatctctgtttcatttccattgaccgccactgtgccatctgtgaccccctg
ctctatccctccaagttcacagtgagggtggctctcaggtacatcctggcaggatggggg
gtgcccgcagcatacacttcgttattcctctacacagatgtggtagagacaaggctcagc
cagtggctggaagagatgccttgtgtgggcagttgccagctgctgctcaataaattttgg
ggctggttaaacttccctttgttctttgtcccctgcctcattatgatcagcttgtatgtg
aagatctttgtggttgctaccagacaggctcagcagattaccacattgagcaaaagcctg
gctggggctgccaagcatgagagaaaagctgccaagaccctgggcattgctgtgggcata
tacctcttgtgctggctgcccttcaccatagacacgatggtcgacagcctccttcacttt
atcacacccccactggtctttgacatctttatctggtttgcttacttcaactcagcctgc
aaccccatcatctatgtcttttcctaccagtggtttcggaaggcactgaaactcacactg
agccagaaggtcttctcaccgcagacacgcactgttgatttgtaccaagaatga

DBGET integrated database retrieval system