KEGG   Homo sapiens (human): 9039
Entry
9039              CDS       T01001                                 

Gene name
UBA3, NAE2, UBE1C, hUBA3
Definition
(RefSeq) ubiquitin like modifier activating enzyme 3
  KO
K10686  ubiquitin-activating enzyme E1 C [EC:6.2.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9039 (UBA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9039 (UBA3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     9039 (UBA3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   9039 (UBA3)
SSDB
Motif
Pfam: ThiF E2_bind UAE_UbL Shikimate_DH Pyr_redox
Other DBs
NCBI-GeneID: 9039
NCBI-ProteinID: NP_003959
OMIM: 603172
HGNC: 12470
Ensembl: ENSG00000144744
Vega: OTTHUMG00000154325
Pharos: Q8TBC4(Tbio)
UniProt: Q8TBC4
Structure
PDB: 

Position
3p14.1
AA seq 463 aa
MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPST
ESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDI
GRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLI
SLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIA
SMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYR
LTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAER
KENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS
IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcggatggcgaggagccggagaagaaaagaaggagaatagaggagctgctggctgag
aaaatggctgttgatggtgggtgtggggacactggagactgggaaggtcgctggaaccat
gtaaagaagttcctcgagcgatctggacccttcacacaccctgatttcgaaccgagcact
gaatctctccagttcttgttagatacatgtaaagttctagtcattggagctggcggctta
ggatgtgagctcctgaaaaatctggccttgtctggttttagacagattcatgttatagat
atggacactatagatgtttccaatctaaataggcagtttttatttaggcctaaagatatt
ggaagacctaaggctgaagttgctgcagaatttctaaatgacagagttcctaattgcaat
gtagttccacatttcaacaagattcaagattttaacgacactttctatcgacaatttcat
attattgtatgtggactggactctatcatcgccagaagatggataaatggcatgctgata
tctcttctaaattatgaagatggtgtcttagatccaagctccattgtccctttgatagat
ggggggacagaaggttttaaaggaaatgcccgggtgattctgcctggaatgactgcttgt
atcgaatgcacgctggaactttatccaccacaggttaattttcccatgtgcaccattgca
tctatgcccaggctaccagaacactgtattgagtatgtaaggatgttgcagtggcctaag
gagcagccttttggagaaggggttccattagatggagatgatcctgaacatatacaatgg
attttccaaaaatccctagagagagcatcacaatataatattaggggtgttacgtatagg
ctcactcaaggggtagtaaaaagaatcattcctgcagtagcttccacaaatgcagtcatt
gcagctgtgtgtgccactgaggtttttaaaatagccacaagtgcatacattcccttgaat
aattacttggtgtttaatgatgtagatgggctgtatacatacacatttgaagcagaaaga
aaggaaaactgcccagcttgtagccagcttcctcaaaatattcagttttctccatcagct
aaactacaggaggttttggattatctaaccaatagtgcttctctgcaaatgaaatctcca
gccatcacagccaccctagagggaaaaaatagaacactttacttacagtcggtaacctct
attgaagaacgaacaaggccaaatctctccaaaacattgaaagaattggggcttgttgat
ggacaagaactggcggttgctgatgtcaccaccccacagactgtactattcaaacttcat
tttacttcttaa

DBGET integrated database retrieval system