KEGG   Homo sapiens (human): 904Help
Entry
904               CDS       T01001                                 

Gene name
CCNT1, CCNT, CYCT1, HIVE1
Definition
(RefSeq) cyclin T1
  KO
K15188  cyclin T
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    904 (CCNT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    904 (CCNT1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     904 (CCNT1)
    Brd4/P-TEFb complex
     904 (CCNT1)
    7SK RNP complex
     904 (CCNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 904
NCBI-ProteinID: NP_001231
OMIM: 143055
HGNC: 1599
Ensembl: ENSG00000129315
Vega: OTTHUMG00000170393
Pharos: O60563(Tchem)
UniProt: O60563
Structure
PDB: 

Position
12q13.11-q13.12
AA seq 726 aa AA seqDB search
MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTIN
TAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPD
TRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN
SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLM
SMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGV
DHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY
AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEI
KMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNK
RPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSL
NFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDT
VNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPP
LPPLPK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggagggagagaggaagaacaacaacaaacggtggtatttcactcgagaacagctggaa
aatagcccatcccgtcgttttggcgtggacccagataaagaactttcttatcgccagcag
gcggccaatctgcttcaggacatggggcagcgtcttaacgtctcacaattgactatcaac
actgctatagtatacatgcatcgattctacatgattcagtccttcacacagttccctgga
aattctgtggctccagcagccttgtttctagcagctaaagtggaggagcagcccaaaaaa
ttggaacatgtcatcaaggtagcacatacttgtctccatcctcaggaatcccttcctgat
actagaagtgaggcttatttgcaacaagttcaagatctggtcattttagaaagcataatt
ttgcagactttaggctttgaactaacaattgatcacccacatactcatgtagtaaagtgc
actcaacttgttcgagcaagcaaggacttagcacagacttcttacttcatggcaaccaac
agcctgcatttgaccacatttagcctgcagtacacacctcctgtggtggcctgtgtctgc
attcacctggcttgcaagtggtccaattgggagatcccagtctcaactgacgggaagcac
tggtgggagtatgttgacgccactgtgaccttggaacttttagatgaactgacacatgag
tttctacagattttggagaaaactcccaacaggctcaaacgcatttggaattggagggca
tgcgaggctgccaagaaaacaaaagcagatgaccgaggaacagatgaaaagacttcagag
cagacaatcctcaatatgatttcccagagctcttcagacacaaccattgcaggtttaatg
agcatgtcaacttctaccacaagtgcagtgccttccctgccagtctccgaagagtcatcc
agcaacttaaccagtgtggagatgttgccgggcaagcgttggctgtcctcccaaccttct
ttcaaactagaacctactcagggtcatcggactagtgagaatttagcacttacaggagtt
gatcattccttaccacaggatggttcaaatgcatttatttcccagaagcagaatagtaag
agtgtgccatcagctaaagtgtcactgaaagaataccgcgcgaagcatgcagaagaattg
gctgcccagaagaggcaactggagaacatggaagccaatgtgaagtcacaatatgcatat
gctgcccagaatctcctttctcatcatgatagccattcttcagtcattctaaaaatgccc
atagagggttcagaaaaccccgagcggccttttctggaaaaggctgacaaaacagctctc
aaaatgagaatcccagtggcaggtggagataaagctgcgtcttcaaaaccagaggagata
aaaatgcgcataaaagtccatgctgcagctgataagcacaattctgtagaggacagtgtt
acaaagagccgagagcacaaagaaaagcacaagactcacccatctaatcatcatcatcat
cataatcaccactcacacaagcactctcattcccaacttccagttggtactgggaacaaa
cgtcctggtgatccaaaacatagtagccagacaagcaacttagcacataaaacctatagc
ttgtctagttctttttcctcttccagttctactcgtaaaaggggaccctctgaagagact
ggaggggctgtgtttgatcatccagccaagattgccaagagtactaaatcctcttcccta
aatttctccttcccttcacttcctacaatgggtcagatgcctgggcatagctcagacaca
agtggcctttccttttcacagcccagctgtaaaactcgtgtccctcattcgaaactggat
aaagggcccactggggccaatggtcacaacacgacccagacaatagactatcaagacact
gtgaatatgcttcactccctgctcagtgcccagggtgttcagcccactcagcccactgca
tttgaatttgttcgtccttatagtgactatctgaatcctcggtctggtggaatctcctcg
agatctggcaatacagacaaaccccggccaccacctctgccatcagaacctcctccacca
cttccaccccttcctaagtaa

DBGET integrated database retrieval system