KEGG   Homo sapiens (human): 9040Help
Entry
9040              CDS       T01001                                 

Gene name
UBE2M, UBC-RS2, UBC12, hUbc12
Definition
(RefSeq) ubiquitin conjugating enzyme E2 M
  KO
K10579  ubiquitin-conjugating enzyme E2 M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9040 (UBE2M)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9040 (UBE2M)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   9040 (UBE2M)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con
Motif
Other DBs
NCBI-GeneID: 9040
NCBI-ProteinID: NP_003960
OMIM: 603173
HGNC: 12491
Ensembl: ENSG00000130725
Vega: OTTHUMG00000183548
Pharos: P61081(Tbio)
UniProt: P61081 A0A024R4T4
Structure
PDB: 

Position
19q13.43
AA seq 183 aa AA seqDB search
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNF
KLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWK
PVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFER
CLK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgttctcgctgaagcagcagaagaaggaggaggagtcggcgggcggcacc
aagggcagcagcaagaaggcgtcggcggcgcagctgcggatccagaaggacataaacgag
ctgaacctgcccaagacgtgtgatatcagcttctcagatccagacgacctcctcaacttc
aagctggtcatctgtcctgatgagggcttctacaagagtgggaagtttgtgttcagtttt
aaggtgggccagggttacccgcatgatccccccaaggtgaagtgtgagacaatggtctat
caccccaacattgacctcgagggcaacgtctgcctcaacatcctcagagaggactggaag
ccagtccttacgataaactccataatttatggcctgcagtatctcttcttggagcccaac
cccgaggacccactgaacaaggaggccgcagaggtcctgcagaacaaccggcggctgttt
gagcagaacgtgcagcgctccatgcggggtggctacatcggctccacctactttgagcgc
tgcctgaaatag

DBGET integrated database retrieval system