KEGG   Homo sapiens (human): 90423Help
Entry
90423             CDS       T01001                                 

Gene name
ATP6V1E2, ATP6E1, ATP6EL2, ATP6V1EL2, VMA4
Definition
(RefSeq) ATPase H+ transporting V1 subunit E2
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    90423 (ATP6V1E2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    90423 (ATP6V1E2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    90423 (ATP6V1E2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    90423 (ATP6V1E2)
  Nervous system
   04721 Synaptic vesicle cycle
    90423 (ATP6V1E2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    90423 (ATP6V1E2)
  Infectious diseases
   05110 Vibrio cholerae infection
    90423 (ATP6V1E2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    90423 (ATP6V1E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: vATP-synt_E DUF4288 Av_adeno_fibre
Motif
Other DBs
NCBI-GeneID: 90423
NCBI-ProteinID: NP_001304992
OMIM: 617385
HGNC: 18125
Ensembl: ENSG00000250565
Vega: OTTHUMG00000128819
Pharos: Q96A05(Tdark)
UniProt: Q96A05 A0A140VKA8
Position
2p21; 2p16-p12
AA seq 226 aa AA seqDB search
MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKILMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
LQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGG
VEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKFFI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagtgatgtcgatgtgaaaaagcagattaagcacatgatggctttcattgag
caggaagccaatgagaaagcagaggaaatcgatgccaaggctgaggaagagtttaacatt
gagaaaggacgcctcgtgcaaacccaacgactgaagattatggagtattatgagaaaaag
gagaagcagatagagcagcagaagaaaatcctgatgtccaccatgaggaatcaggcgagg
ctgaaagtcctgagagcccgaaatgacctcatctcagatttgctcagtgaggcgaagctg
agactcagcaggattgtggaggacccagaggtctaccaggggctgctggataaactggtg
ctccagggtctgctccgactgctggaacctgtgatgattgtacgctgccggccacaagac
ctcctcctggtggaggctgctgtacaaaaagccatccccgagtacatgacaatttcccag
aaacatgtggaggtccagattgataaagaggcatacctggctgtgaatgcagctggaggt
gtggaggtctacagtggcaatcagagaataaaggtttcaaataccttggaaagccgactg
gatctctcagccaagcaaaagatgccagaaatacgaatggccttgtttggtgctaacacc
aacagaaagttctttatataa

DBGET integrated database retrieval system