KEGG   Homo sapiens (human): 9044Help
Entry
9044              CDS       T01001                                 

Gene name
BTAF1, MOT1, TAF(II)170, TAF172, TAFII170
Definition
(RefSeq) B-TFIID TATA-box binding protein associated factor 1
  KO
K15192  TATA-binding protein-associated factor [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9044 (BTAF1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     9044 (BTAF1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     9044 (BTAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3535 SNF2_N HEAT Helicase_C Vac14_Fab1_bd HEAT_2 Cnd1 HEAT_EZ Rac1
Motif
Other DBs
NCBI-GeneID: 9044
NCBI-ProteinID: NP_003963
OMIM: 605191
HGNC: 17307
Ensembl: ENSG00000095564
Vega: OTTHUMG00000018752
Pharos: O14981(Tbio)
UniProt: O14981 Q2M1V9 Q8N6J1
Position
10q23.32
AA seq 1849 aa AA seqDB search
MAVSRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSANWDTRI
AAGQAVEAIVKNVPEWNPVPRTRQEPTSESSMEDSPTTERLNFDRFDICRLLQHGASLLG
SAGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTS
ASFVNKQPTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKSNDSTDG
EPEEKRRKIANVVINQSANDSKVLIDNIPDSSSLIEETNEWPLESFCEELCNDLFNPSWE
VRHGAGTGLREILKAHGKSGGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDRFGDFVS
DEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVR
QDVINTLLPKVLTRIIEGLQDLDDDVRAVAAASLVPVVESLVYLQTQKVPFIINTLWDAL
LELDDLTASTNSIMTLLSSLLTYPQVQQCSIQQSLTVLVPRVWPFLHHTISSVRRAALET
LFTLLSTQDQNSSSWLIPILPDMLRHIFQFCVLESSQEILDLIHKVWMELLSKASVQYVV
AAACPWMGAWLCLMMQPSHLPIDLNMLLEVKARAKEKTGGKVRQGQSQNKEVLQEYIAGA
DTIMEDPATRDFVVMRARMMAAKLLGALCCCICDPGVNVVTQEIKPAESLGQLLLFHLNS
KSALQRISVALVICEWAALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRMQNECKQ
LISSLADVHIEVGNRVNNNVLTIDQASDLVTTVFNEATSSFDLNPQVLQQLDSKRQQVQM
TVTETNQEWQVLQLRVHTFAACAVVSLQQLPEKLNPIIKPLMETIKKEENTLVQNYAAQC
IAKLLQQCTTRTPCPNSKIIKNLCSSLCVDPYLTPCVTCPVPTQSGQENSKGSTSEKDGM
HHTVTKHRGIITLYRHQKAAFAITSRRGPTPKAVKAQIADLPAGSSGNILVELDEAQKPY
LVQRRGAEFALTTIVKHFGGEMAVKLPHLWDAMVGPLRNTIDINNFDGKSLLDKGDSPAQ
ELVNSLQVFETAAASMDSELHPLLVQHLPHLYMCLQYPSTAVRHMAARCVGVMSKIATME
TMNIFLEKVLPWLGAIDDSVKQEGAIEALACVMEQLDVGIVPYIVLLVVPVLGRMSDQTD
SVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIPV
PINAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSK
LAECMPLPSLVVCPPTLTGHWVDEVGKFCSREYLNPLHYTGPPTERIRLQHQVKRHNLIV
ASYDVVRNDIDFFRNIKFNYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNV
LELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFL
LRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLSEETEKP
KLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTAEKLAVQNSSLHDIQHAPKLSALK
QLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGS
IPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRA
HRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTL
DKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK
NT seq 5550 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctccaggctagatcgcctttttattttactggatactggcactactcctgtt
acaagaaaagctgctgcacagcaacttggagaagtggtgaagcttcatccccatgaacta
aataatctcctgtctaaagtgttgatatatttaaggagtgcaaattgggatacccggatt
gcagcaggacaagctgttgaagctatagtgaaaaatgtacctgagtggaatccagtgccg
agaaccagacaagaacctacttccgaaagttctatggaagattcacctactacagagcga
ttgaattttgacagatttgatatatgtagattgttacaacatggtgcatcactcctggga
tctgctggtgccgaatttgaagtccaagatgaaaaatcaggtgaagtggatcctaaagag
aggatagcacgccaacgaaaattattacagaagaaacttggccttaatatgggagaagca
attggaatgagtactgaagaacttttcaatgatgaggatttggattataccccaacttca
gcatcctttgttaacaaacaacctactcttcaggcagctgaattgattgactcagagttt
cgagcaggaatgagcaatagacaaaagaacaaagctaaaagaatggccaagttatttgca
aaacagagatccagggatgcagtggaaactaatgagaagagcaatgatagcactgatggg
gagccagaagaaaagagacggaaaatagcaaatgttgttattaatcagtctgcaaatgat
tccaaagtcttgattgataatattccagacagctcttccttaattgaagagacaaatgaa
tggcctttggaaagcttttgtgaagaactttgcaatgacctttttaatccctcctgggag
gttcgacatggtgcaggcactggacttagggaaattcttaaagctcatgggaaaagtggt
ggtaaaatgggtgacagcactttagaagagatgattcagcagcatcaagagtggttggaa
gacttggttattagactcctttgtgtttttgcattagacagatttggagactttgtttct
gatgaagttgtggcaccagttcgtgaaacttgtgctcaaacattaggtgtggttttaaaa
cacatgaacgaaacaggagttcataagactgtggatgtgctgctaaaattacttacacaa
gaacaatgggaagttagacatggtggtctgctgggaataaaatatgctttggcagtccgt
caggatgtaattaatactttattgcctaaagttttaactagaataattgaaggactccag
gatcttgatgatgatgtcagagctgttgctgcagcatcattagtgcctgtagtagaaagc
cttgtctatcttcagacacaaaaggtgcccttcattataaatacattgtgggatgctctt
ctggaattagatgatctaacagcttcaacaaatagtattatgactctcctttcatccttg
ttaacttaccctcaggtccaacaatgcagtattcagcagtcactgacagttttagttcca
cgtgtctggccttttttgcatcacactatatcatcagttcgaagagcagcattggaaact
ctgtttacgttattatcaacacaggaccagaactcttcatcttggcttatacctatactg
cctgatatgctccgacacatttttcagttctgtgttttggaaagcagccaggaaattctg
gaccttattcacaaggtttggatggaactgttgagtaaggcttcagttcagtatgtggta
gcagctgcttgcccatggatgggtgcttggctttgcttgatgatgcagccttctcattta
cctatcgatttaaatatgttgctagaagtaaaagctagagccaaggaaaaaacaggtggt
aaggtgcgccaaggccaaagccagaataaagaagtacttcaggagtatattgcaggtgcc
gacaccatcatggaagacccagccaccagggattttgtagttatgcgggccagaatgatg
gcagccaagttgttaggagcactttgttgctgtatttgtgatccaggtgtaaatgtggta
actcaagaaattaaaccagctgaatccctgggccagttactactcttccatttgaactcc
aagtctgctttacagaggattagtgtagctttggtaatctgtgaatgggctgctttacaa
aaggagtgtaaagctgttaccttagctgtgcagccgcgtttacttgatatcctttcagaa
catttatattatgacgaaattgccgttccattcacacgaatgcagaatgaatgtaaacaa
cttatatcatcattagctgatgtacatattgaagttggtaatcgagtaaacaacaatgtt
ttaacaatagatcaagctagtgacttggtcactactgtttttaatgaagccacatcatct
ttcgatttaaatcctcaagtgttacaacagttagatagtaaacgacagcaggtccaaatg
acagttacagagaccaaccaggagtggcaagtgttgcagttgagagtgcatacttttgct
gcctgtgcagttgtgagcttgcagcagcttccggagaaattaaatcctatcataaaacca
ttaatggagacaattaaaaaagaagagaatacactagtgcaaaactatgcagctcagtgc
atagctaaactccttcagcagtgcacaacaaggacgccctgtcccaattcaaaaattatt
aaaaacctctgtagctcactttgtgtggacccatatctaactccttgtgtcacatgtcca
gtaccaacacaaagtggccaggaaaattctaaaggatccacctcagaaaaagatggaatg
caccatactgtcaccaagcacagaggtataattacactctacaggcaccagaaagctgcc
tttgctatcacaagtaggcgaggtcctacccccaaagcagtaaaagctcaaatagcagat
cttcctgcaggaagtagtggaaatattcttgttgaacttgatgaggcccagaagccttac
ctggtacaacggagaggagctgaatttgctttgacaactatagtaaagcattttggtggt
gaaatggcagtgaagttgccacatctctgggatgctatggttggcccattgaggaataca
atcgacataaataattttgatggaaaatccctcctggataagggagatagccctgctcaa
gaattggtgaattctctgcaggtttttgaaacagcagcagcttcaatggattctgagctt
catcccttgttggtccagcatttgccacatctttatatgtgccttcaataccccagtact
gcagtgaggcacatggctgctcgttgtgtaggtgtcatgagcaaaatagctaccatggaa
acaatgaatatttttttggagaaggttcttccgtggctgggagcaattgatgacagtgtc
aaacaagagggtgcaattgaagcacttgcctgtgtaatggaacaactagatgttggtatt
gttccatatattgtccttttagttgttcctgtattaggaagaatgagtgatcagacagac
agtgtgagattcatggccacgcagtgctttgcaacgctaattagactcatgccacttgag
gcaggcattccagaccctccaaacatgtcagcagaattaatccaattgaaagccaaggag
cgacactttttggagcaattgttagatgggaaaaaattggaaaattataaaattccagta
ccaatcaatgctgaactcagaaaatatcagcaggatggtgtgaactggttagcatttctt
aataagtataaacttcatggaattctgtgtgatgacatgggtttaggaaaaactttacag
tccatctgcattctagcaggagatcattgtcatagggcccaggaatatgcaagatcaaaa
ttagcagaatgtatgccacttccttccttagtggtttgtccgccaacattaacaggccat
tgggtggatgaagtaggtaaattttgctctagagaatatctcaacccgttgcattacact
ggacctcccactgaaagaataaggttacagcaccaagtaaaaaggcacaatctaatagtg
gcttcatatgatgttgtgaggaatgacatagatttctttagaaatattaaatttaactac
tgcattcttgatgaaggccatgtcatcaaaaatggaaaaacaaagttgtcaaaagcagta
aaacaactgactgctaattataggattattctttctggaacaccaatccagaacaacgtt
ttggagctgtggtcattatttgatttcctcatgccaggatttttgggtactgaacgccag
tttgctgctcgatatggtaaacctatattagcaagtagggatgctcgaagctccagtcga
gagcaagaagcaggtgttcttgctatggatgcgctgcaccgccaagtactaccgtttctt
ttgagaagaatgaaagaagatgttttgcaggatcttccacctaaaattattcaagactat
tattgtactcttagtcctctccaggttcagctctatgaagattttgctaagtctcgtgcc
aagtgtgatgttgatgaaacagtttcttcagctacactttctgaagaaactgaaaaacca
aagcttaaagctacaggccacgtattccaggcattacagtacttacgtaaactgtgcaac
catccagcattagtcttaacacctcaacatccagaattcaagaccactgccgaaaaactg
gcagttcagaattcttctctacatgatattcaacatgcccctaagctctcagctttgaaa
caattgctgttggactgcggtttgggaaatggcagcacttccgagagtggcacagagtct
gttgtggcccagcacaggatactgatattctgtcagctgaaaagcatgcttgatatagta
gagcatgatctcctcaaacctcacttgccctctgtcacttatttgagattagatggcagc
atacctcctggtcagaggcattccattgtttcccggtttaataatgatccatctatagac
gttctgttacttaccactcacgttggtggcctgggacttaatttgacaggcgctgacaca
gtagtatttgtggagcatgactggaatcctatgcgagatctacaagccatggaccgggcc
catcgcattgggcagaaacgtgtggttaacgtataccgattgataaccagaggaacattg
gaagaaaaaataatggggttgcagaaattcaagatgaacatagcgaatactgttattagc
caagagaattctagtttgcagagcatggggactgatcagcttcttgatctgtttactctt
gataaggatggcaaagcagaaaaagctgacacctctacttctgggaaagcaagtatgaaa
tcaattcttgaaaacctgagtgatctttgggatcaagagcagtatgattcagagtacagc
ctggaaaattttatgcattctctcaagtaa

DBGET integrated database retrieval system