KEGG   Homo sapiens (human): 9046
Entry
9046              CDS       T01001                                 

Gene name
DOK2, p56DOK, p56dok-2
Definition
(RefSeq) docking protein 2
  KO
K20234  docking protein 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: IRS PH
Other DBs
NCBI-GeneID: 9046
NCBI-ProteinID: NP_003965
OMIM: 604997
HGNC: 2991
Ensembl: ENSG00000147443
Vega: OTTHUMG00000131075
Pharos: O60496(Tbio)
UniProt: O60496
Structure
PDB: 
2DLW 2D9W

Position
8p21.3
AA seq 412 aa
MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVI
RLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKE
LSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALE
LWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEE
AISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYA
VPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSP
QEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgggagacggggcagtgaaacaaggcttcttgtatcttcagcagcagcagacgtttgga
aagaaatggcgccgcttcggcgcctcactgtatggagggtcggactgcgccttggcccgg
ctggagctgcaggagggcccggagaagcctcgtcggtgtgaggctgcccggaaggtcatc
cgcctcagtgactgcctgcgggtggccgaggccggcggagaggccagcagcccccgggac
accagtgccttcttcctggagaccaaggagcgcctgtacctcctggcggcccctgcagcg
gagcgcggcgactgggtgcaggccatctgcctcctggccttccccgggcagaggaaggag
ctctcggggccagagggaaagcagagccggccctgcatggaggaaaatgaattgtacagc
agcgcagtcacagtcggcccccacaaggaatttgctgtgaccatgagacctacagaagcc
agtgagaggtgccacctgcgggggtcctataccctccgggctggggagagtgccctggag
ctgtggggtgggcccgagccagggacccagctgtacgactggccctacaggtttctgcgg
cgctttgggcgggacaaggtaaccttttcctttgaggcaggccgtcgctgcgtctctgga
gagggcaactttgagttcgaaacccggcaaggcaatgagatcttcttggccctggaagag
gccatctctgcccagaagaatgctgcacccgctacaccccaaccgcagccagccacaatc
cccgcgtcgctgccccggcctgatagcccctactctcggccgcatgactcactgccgccg
ccttcacccaccacaccggtgcctgctccacggcctcggggccaggagggggagtatgcc
gtgcccttcgatgcggtggcccgttccttggggaagaacttcaggggcatcttggcagtc
cctcctcagctcctggccgaccctctgtacgacagcattgaggagaccctgccccctcga
cctgaccacatatacgatgagcccgagggagtggctgccctgtccctctatgacagcccg
caggagccccggggtgaggcatggaggaggcaggcgacagctgacagggaccctgctggc
ctccagcatgtccagccagccgggcaggatttctctgcttctggctggcagccaggaact
gagtatgacaatgttgtactaaagaaaggcccaaagtga

DBGET integrated database retrieval system