KEGG   Homo sapiens (human): 90480Help
Entry
90480             CDS       T01001                                 

Gene name
GADD45GIP1, CKBBP2, CKbetaBP2, CRIF1, MRP-L59, PLINP, PLINP-1, PRG6, Plinp1
Definition
(RefSeq) GADD45G interacting protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CR6_interact Mitoc_mL59
Motif
Other DBs
NCBI-GeneID: 90480
NCBI-ProteinID: NP_443082
OMIM: 605162
HGNC: 29996
Ensembl: ENSG00000179271
Vega: OTTHUMG00000180724
Pharos: Q8TAE8(Tbio)
UniProt: Q8TAE8
Structure
PDB: 

Position
19p13.13
AA seq 222 aa AA seqDB search
MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQ
FARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQH
IAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQ
DLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccgtgcgacaggcacgcagcctactaggtgtggcggcgaccctggccccg
ggttcccgtggctaccgggcgcggccgcccccgcgccgcaggccgggaccccggtggcca
gaccccgaggacctcctgaccccgcggtggcagctgggaccgcgctacgcggctaagcag
ttcgcgcgttacggcgccgcctccggggtggtccccggttcgttatggccgtcgccggag
cagctgcgggagctggaggccgaagaacgcgaatggtacccgagcctggcgaccatgcag
gagtcgctgcgggtgaagcagctggccgaagagcagaagcgtcgggagagggagcagcac
atcgcagagtgcatggccaagatgccacagatgattgtgaactggcagcagcagcagcgg
gagaactgggagaaggcccaggctgacaaggagaggagggcccgactgcaggctgaggcc
caggagctcctgggctaccaggtggacccaaggagtgcccgcttccaggagctgctccag
gacctagagaagaaggagcgcaagcgcctcaaggaggaaaaacagaaacggaagaaggag
gcgcgagctgctgcattggctgcagctgtggctcaagacccagcagcctctggggcaccc
agctcctga

DBGET integrated database retrieval system