KEGG   Homo sapiens (human): 90488Help
Entry
90488             CDS       T01001                                 

Gene name
TMEM263, C12orf23
Definition
(RefSeq) transmembrane protein 263
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0444
Motif
Other DBs
NCBI-GeneID: 90488
NCBI-ProteinID: NP_001306590
HGNC: 28281
Ensembl: ENSG00000151135
Vega: OTTHUMG00000170014
Pharos: Q8WUH6(Tdark)
UniProt: Q8WUH6
Position
12q23.3
AA seq 116 aa AA seqDB search
MNQTDKNQQEIPSYLNDEPPEGSMKDHPQQQPGMLSRVTGGIFSVTKGAVGATIGGVAWI
GGKSLEVTKTAVTTVPSMGIGLVKGGVSAVAGGVTAVGSAVVNKVPLTGKKKDKSD
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagacagataaaaatcaacaagaaatcccatcataccttaatgatgaaccacca
gaaggttcaatgaaagatcacccacagcagcagccaggcatgttgtcccgtgtgactggg
ggtatcttcagtgttacaaagggagctgttggtgccaccattggtggtgtggcttggatt
ggtggaaagagtctggaagtgaccaaaacagctgttacaactgtgccttccatgggaata
gggctggtgaaagggggtgtctctgctgtggctggaggtgttacagctgttgggtctgct
gttgtaaacaaagtgcccttaacaggaaagaagaaagacaaatctgactga

DBGET integrated database retrieval system