KEGG   Homo sapiens (human): 9049Help
Entry
9049              CDS       T01001                                 

Gene name
AIP, ARA9, FKBP16, FKBP37, PITA1, SMTPHN, XAP-2, XAP2
Definition
(RefSeq) aryl hydrocarbon receptor interacting protein
  KO
K17767  AH receptor-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04934  Cushing syndrome
Network
nt06319  AHR-cell cycle regulation
nt06360  Cushing syndrome
  Element
N00315  Mutation-inactivated AIP to AhR-mediated transcription
Disease
H01102  Pituitary adenomas
H01431  Cushing syndrome
H01483  Acromegaly
H01864  Excessive secretion of growth hormone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    9049 (AIP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9049 (AIP)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    9049 (AIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_2 TPR_8
Motif
Other DBs
NCBI-GeneID: 9049
NCBI-ProteinID: NP_003968
OMIM: 605555
HGNC: 358
Ensembl: ENSG00000110711
Vega: OTTHUMG00000167674
Pharos: O00170(Tbio)
UniProt: O00170 G9I2H4
Structure
PDB: 

Position
11q13.2
AA seq 330 aa AA seqDB search
MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRH
CCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVP
LIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQC
KLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
VVSRELRALEARIRQKDEEDKARFRGIFSH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatcatcgcaagactccgggaggacgggatccaaaaacgtgtgatacaggaa
ggccgaggagagctcccggactttcaagatgggaccaaggccacgttccactaccggacg
ctgcacagtgacgacgagggcaccgtgctggacgacagccgggctcgtggcaagcccatg
gagctcatcattggcaagaagttcaagctgcctgtgtgggagaccatcgtgtgcaccatg
cgagaaggggagattgcccagttcctctgtgacatcaagcatgtggtcctgtacccgctg
gtggccaagagtctccgcaacatcgcggtgggcaaggaccccctggagggccagcggcac
tgctgcggtgttgcacagatgcgtgaacacagctccctgggccatgctgacctggacgcc
ctgcagcagaacccccagcccctcatcttccacatggagatgctgaaggtggagagccct
ggcacgtaccagcaggacccatgggccatgacagacgaagagaaggcaaaggcagtgcca
cttatccaccaggagggcaaccggttgtaccgcgaggggcatgtgaaggaggctgctgcc
aagtactacgatgccattgcctgcctcaagaacctgcagatgaaggaacagcctgggtcc
cctgaatggatccagctggaccagcagatcacgccgctgctgctcaactactgccagtgc
aagctggtggtcgaggagtactacgaggtgctggaccactgctcttccatcctcaacaag
tacgacgacaacgtcaaggcctacttcaagcggggcaaggcccacgcggccgtgtggaat
gcccaggaggcccaggctgactttgccaaagtgctggagctggacccagccctggcgcct
gtggtgagccgagagctgcgggccctggaggcacggatccggcagaaggacgaagaggac
aaagcccggttccgggggatcttctcccattga

DBGET integrated database retrieval system