KEGG   Homo sapiens (human): 90550Help
Entry
90550             CDS       T01001                                 

Gene name
MCU, C10orf42, CCDC109A, HsMCU
Definition
(RefSeq) mitochondrial calcium uniporter
  KO
K20858  calcium uniporter protein, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04218  Cellular senescence
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    90550 (MCU)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    90550 (MCU)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    90550 (MCU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    90550 (MCU)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    90550 (MCU)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    90550 (MCU)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   90550 (MCU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCU SPX
Motif
Other DBs
NCBI-GeneID: 90550
NCBI-ProteinID: NP_612366
OMIM: 614197
HGNC: 23526
Ensembl: ENSG00000156026
Vega: OTTHUMG00000018443
Pharos: Q8NE86(Tbio)
UniProt: Q8NE86
Structure
PDB: 

Position
10q22.1
AA seq 351 aa AA seqDB search
MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQN
LGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDR
GIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVK
TLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGL
AYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYL
LFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgcaggtagatcgctcctgctgctcctctcctctcggggcggcggcggc
gggggcgccggcggctgcggggcgctgactgccggctgcttccctgggctgggcgtcagc
cgccaccggcagcagcagcaccaccggacggtacaccagaggatcgcttcctggcagaat
ttgggagctgtttattgcagcactgttgtgccctctgatgatgttacagtggtttatcaa
aatgggttacctgtgatatctgtgaggctaccatcccggcgtgaacgctgtcagttcaca
ctcaagcctatctctgactctgttggtgtatttttacgacaactgcaagaagaggatcgg
ggaattgacagagttgctatctattcaccagatggtgttcgcgttgctgcttcaacagga
atagacctcctcctccttgatgactttaagctggtcattaatgacttaacataccacgta
cgaccaccaaaaagagacctcttaagtcatgaaaatgcagcaacgctgaatgatgtaaag
acattggtccagcaactatacaccacactgtgcattgagcagcaccagttaaacaaggaa
agggagcttattgaaagactagaggatctcaaagagcagctggctcccctggaaaaggta
cgaattgagattagcagaaaagctgagaagaggaccactttggtgctatggggtggcctt
gcctacatggccacacagtttggcattttggcccggcttacctggtgggaatattcctgg
gacatcatggagccagtaacatacttcatcacttatggaagtgccatggcaatgtatgca
tattttgtaatgacacgccaggaatatgtttatccagaagccagagacagacaatactta
ctatttttccataaaggagccaaaaagtcacgttttgacctagagaaatacaatcaactc
aaggatgcaattgctcaggcagaaatggaccttaagagactgagagacccattacaagta
catctgcctctccgacaaattggtgaaaaagattga

DBGET integrated database retrieval system