KEGG   Homo sapiens (human): 90557
Entry
90557             CDS       T01001                                 
Symbol
CCDC74A
Name
(RefSeq) coiled-coil domain containing 74A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CCDC74_C CCDC92 DUF3972 FAD-SLDH
Other DBs
NCBI-GeneID: 90557
NCBI-ProteinID: NP_620125
HGNC: 25197
Ensembl: ENSG00000163040
Pharos: Q96AQ1(Tdark)
UniProt: Q96AQ1 A0A384MR57
Position
2:131522592..131533666
AA seq 378 aa
MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFL
QQQHSEMLAKLHEEIEHLKRENKDLHYKLIMNQTSQKKDGPSGNHLSRASAPLGARWVCI
NGVWVEPGGPSPARLKEGSSRTHRPGGKRGRLAGGSADTVRSPADSLSMSSFQSVKSISN
SGKARPQPGSFNKQDSKADVSQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAA
CMGNSQHQGRQMGAGAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELRHLKSLL
EGSQRPQAAPEEASFPRDQEATHFPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAE
RQKRLQAMQKRRLHRSVL
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagcggtgcgggggtggcggctgggacgcggccccccagctcgccgaccccgggctct
cggcgccggcgccagcgcccctctgtgggcgtccagtccttgaggccgcagagcccgcag
ctcaggcagagcgacccgcagaaacggaacctggacctggagaaaagcctgcagttcctg
cagcagcagcactcggagatgctggccaagctccatgaggagatcgagcatctgaagcgg
gaaaacaaggatctccattacaagctcataatgaatcagacatcacagaagaaagatggc
ccctcaggaaaccacctttccagggcctctgctcccttgggcgctcgctgggtctgcatc
aacggagtgtgggtagagccgggaggacccagccctgccaggctgaaggagggctcctca
cggacacacaggccaggaggcaagcgtgggcgtcttgcgggcggtagcgccgacactgtg
cgctctcctgcagacagcctctccatgtcaagcttccagtctgtcaagtccatctctaat
tcaggcaaggccaggccccagcccggctccttcaacaagcaagattcaaaagctgacgtc
tcccagaaggcggacctggaagaggagcccctacttcacaacagcaagctggacaaagtt
cctggggtacaagggcaggccagaaaggagaaagcagaggcctctaatgcaggagctgcc
tgtatggggaacagccagcaccagggcaggcagatgggggcgggggcacaccccccaatg
atcctgccccttcccctgcgaaagcccaccacacttaggcagtgcgaagtgctcatccgc
gagctgtggaataccaacctcctgcagacccaagagctgcggcacctcaagtccctcctg
gaagggagccagaggccccaggcagccccggaggaagctagctttcccagggaccaagaa
gccacgcatttccccaaggtctccaccaagagcctctccaagaaatgcctgagcccacct
gtggcggagcgtgccatcctgcccgcactgaagcagaccccgaagaacaactttgccgag
aggcagaagaggctgcaggcaatgcagaaacggcgcctgcatcgctcagtgctttga

DBGET integrated database retrieval system