KEGG   Homo sapiens (human): 9056Help
Entry
9056              CDS       T01001                                 

Gene name
SLC7A7, LAT3, LPI, MOP-2, Y+LAT1, y+LAT-1
Definition
(RefSeq) solute carrier family 7 member 7
  KO
K13867  solute carrier family 7 (L-type amino acid transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00899  Lysinuric protein intolerance
H01400  Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    9056 (SLC7A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9056 (SLC7A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   9056 (SLC7A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-GeneID: 9056
NCBI-ProteinID: NP_001119577
OMIM: 603593
HGNC: 11065
Ensembl: ENSG00000155465
Vega: OTTHUMG00000028692
Pharos: Q9UM01(Tbio)
UniProt: Q9UM01 A0A0S2Z502
Position
14q11.2
AA seq 511 aa AA seqDB search
MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPK
GVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRL
WTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWG
TLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYS
GWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTF
ADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVP
SLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFF
PIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSAT
RYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggttgacagcactgagtatgaagtggcctcccagcctgaggtggaaacctcccctttg
ggtgatggggccagcccagggccggagcaggtgaagctgaagaaggagatctcactgctt
aacggcgtgtgcctgattgtggggaacatgatcggctcgggcatctttgtttcccccaag
ggtgtgctcatatacagtgcctcctttggtctctctctggtcatctgggctgtcgggggc
ctcttctccgtctttggggccctttgttatgcggaactgggcaccaccattaagaaatct
ggggccagctatgcctatatcctggaggcctttggaggattccttgctttcatcagactc
tggacctccctgctcatcattgagcccaccagccaggccatcattgccatcacctttgcc
aactacatggtacagcctctcttcccgagctgcttcgccccttatgctgccagccgcctg
ctggctgctgcctgcatttgtctcttaaccttcattaactgtgcctatgtcaaatgggga
accctggtacaagatattttcacctatgctaaagtattggcactgatcgcggtcatcgtt
gcaggcattgttagacttggccagggagcctctactcattttgagaattcctttgagggt
tcatcatttgcagtgggtgacattgccctggcactgtactcagctctgttctcctactca
ggctgggacaccctcaactatgtcactgaagagatcaagaatcctgagaggaacctgccc
ctctccattggcatctccatgcccattgtcaccatcatctatatcttgaccaatgtggcc
tattatactgtgctagacatgagagacatcttggccagtgatgctgttgctgtgactttt
gcagatcagatatttggaatatttaactggataattccactgtcagttgcattatcctgt
tttggtggcctcaatgcctccattgtggctgcttctaggcttttctttgtgggctcaaga
gaaggccatctccctgatgccatctgcatgatccatgttgagcggttcacaccagtgcct
tctctgctcttcaatggtatcatggcattgatctacttgtgcgtggaagacatcttccag
ctcattaactactacagcttcagctactggttctttgtggggctttctattgtgggtcag
ctttatctgcgctggaaggagcctgatcgacctcgtcccctcaagctcagcgttttcttc
ccgattgtcttctgcctctgcaccatcttcctggtggctgttccactttacagtgatact
atcaactccctcatcggcattgccattgccctctcaggcctgcccttttacttcctcatc
atcagagtgccagaacataagcgaccgctttacctccgaaggatcgtggggtctgccaca
aggtacctccaggtcctgtgtatgtcagttgctgcagaaatggatttggaagatggagga
gagatgcccaagcaacgggatcccaaatctaactaa

DBGET integrated database retrieval system