KEGG   Homo sapiens (human): 9060Help
Entry
9060              CDS       T01001                                 

Gene name
PAPSS2, ATPSK2, BCYM4, SK2
Definition
(RefSeq) 3'-phosphoadenosine 5'-phosphosulfate synthase 2
  KO
K13811  3'-phosphoadenosine 5'-phosphosulfate synthase [EC:2.7.7.4 2.7.1.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00450  Selenocompound metabolism
hsa00920  Sulfur metabolism
hsa01100  Metabolic pathways
Disease
H00522  Brachyolmia
H00761  SEMD, Pakistani type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    9060 (PAPSS2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    9060 (PAPSS2)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    9060 (PAPSS2)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    9060 (PAPSS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     9060 (PAPSS2)
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     9060 (PAPSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APS_kinase ATP-sulfurylase PUA_2 AAA_33 AAA_18 PEPCK_ATP RsgA_GTPase DUF5474 YscJ_FliF
Motif
Other DBs
NCBI-GeneID: 9060
NCBI-ProteinID: NP_004661
OMIM: 603005
HGNC: 8604
Ensembl: ENSG00000198682
Vega: OTTHUMG00000018683
Pharos: O95340(Tbio)
UniProt: O95340 Q5TB52
Structure
PDB: 

Position
10q23.2-q23.31
AA seq 614 aa AA seqDB search
MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISF
ALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITS
FISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDS
DYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAE
AETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDDGVINMSIPIVL
PVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTCTKHPHIKMVM
ESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHAL
LMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAI
FPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAP
GLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKA
WKVLTDYYRSLEKN
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggatcaagaagcaaaagacggagaaccagcagaaatccaccaatgtagtctat
caggcccaccatgtgagcaggaataagagagggcaagtggttggaacaaggggtgggttc
cgaggatgtaccgtgtggctaacaggtctctctggtgctggaaaaacaacgataagtttt
gccctggaggagtaccttgtctcccatgccatcccttgttactccctggatggggacaat
gtccgtcatggccttaacagaaatctcggattctctcctggggacagagaggaaaatatc
cgccggattgctgaggtggctaagctgtttgctgatgctggtctggtctgcattaccagc
tttatttctccattcgcaaaggatcgtgagaatgcccgcaaaatacatgaatcagcaggg
ctgccattctttgaaatatttgtagatgcacctctaaatatttgtgaaagcagagacgta
aaaggcctctataaaagggccagagctggggagattaaaggatttacaggtattgattct
gattatgagaaacctgaaactcctgagcgtgtgcttaaaaccaatttgtccacagtgagt
gactgtgtccaccaggtagtggaacttctgcaagagcagaacattgtaccctatactata
atcaaagatatccacgaactctttgtgccggaaaacaaacttgaccacgtccgagctgag
gctgaaactctcccttcattatcaattactaagctggatctccagtgggtccaggttttg
agcgaaggctgggccactcccctcaaaggtttcatgcgggagaaggagtacttacaggtt
atgcactttgacaccctgctagatgatggcgtgatcaacatgagcatccccattgtactg
cccgtctctgcagaggataagacacggctggaagggtgcagcaagtttgtcctggcacat
ggtggacggagggtagctatcttacgagacgctgaattctatgaacacagaaaagaggaa
cgctgttcccgtgtttgggggacaacatgtacaaaacacccccatatcaaaatggtgatg
gaaagtggggactggctggttggtggagaccttcaggtgctggagaaaataagatggaat
gatgggctggaccaataccgtctgacacctctggagctcaaacagaaatgtaaagaaatg
aatgctgatgcggtgtttgcattccagttgcgcaatcctgtccacaatggccatgccctg
ttgatgcaggacactcgccgcaggctcctagagaggggctacaagcacccggtcctccta
ctacaccctctgggcggctggaccaaggatgacgatgtgcctctagactggcggatgaag
cagcacgcggctgtgctcgaggaaggggtcctggatcccaagtcaaccattgttgccatc
tttccgtctcccatgttatatgctggccccacagaggtccagtggcactgcaggtcccgg
atgattgcgggtgccaatttctacattgtggggagggaccctgcaggaatgccccatcct
gaaaccaagaaggatctgtatgaacccactcatgggggcaaggtcttgagcatggcccct
ggcctcacctctgtggaaatcattccattccgagtggctgcctacaacaaagccaaaaaa
gccatggacttctatgatccagcaaggcacaatgagtttgacttcatctcaggaactcga
atgaggaagctcgcccgggaaggagagaatcccccagatggcttcatggcccccaaagca
tggaaggtcctgacagattattacaggtccctggagaagaactaa

DBGET integrated database retrieval system