KEGG   Homo sapiens (human): 9063Help
Entry
9063              CDS       T01001                                 

Gene name
PIAS2, ARIP3, DIP, MIZ1, PIASX, SIZ2, ZMIZ4
Definition
(RefSeq) protein inhibitor of activated STAT 2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04630  Jak-STAT signaling pathway
Network
nt06230  Cell cycle G1/S
nt06267  Small cell lung cancer
  Element
N00088  Amplified MYC to p15-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9063 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    9063 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9063 (PIAS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     9063 (PIAS2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   9063 (PIAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP PHD
Motif
Other DBs
NCBI-GeneID: 9063
NCBI-ProteinID: NP_004662
OMIM: 603567
HGNC: 17311
Ensembl: ENSG00000078043
Vega: OTTHUMG00000179301
Pharos: O75928(Tbio)
UniProt: O75928
Structure
PDB: 

Position
18q21.1
AA seq 621 aa AA seqDB search
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSS
RSETGVITSSGSNIPDIISLD
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcgaagagttgaggaatatggtttctagttttagggtttctgaactacaa
gtattactaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagg
gcgctgcatttattgaagagcggctgcagccctgcggttcagattaaaatccgagaattg
tatagacgccgatatccacgaactcttgaaggactttctgatttatccacaatcaaatca
tcggttttcagtttggatggtggctcatcacctgtagaacctgacttggccgtggctgga
atccactcgttgccttccacttcagttacacctcactcaccatcctctcctgttggttct
gtgctgcttcaagatactaagcccacatttgagatgcagcagccatctcccccaattcct
cctgtccatcctgatgtgcagttaaaaaatctgcccttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcagcgatttcaagagaagttttttatt
tttgctttgacacctcaacaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtccaagttcagttgagactttgcctggcagagacaagttgc
cctcaagaagataactatccaaatagtctatgtataaaagtaaatgggaagctatttcct
ttgcctggctatgcaccaccgcctaaaaatgggattgaacagaagcgccctggacgcccc
ttgaatattacatctttagttaggttatcttcagctgtgccaaaccaaatttccatttct
tgggcatcagaaattgggaagaattactctatgtctgtatatcttgtacggcagcttaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttactgcagatcctgatagtgaaattgctacaactagcctt
cgggtatccttgatgtgccctttaggaaaaatgaggctgacaatcccatgccgtgcagtg
acttgtacacatctgcagtgttttgatgctgccctctatctacaaatgaatgagaaaaag
cccacctggatttgtcctgtgtgtgacaaaaaagctgcctatgaaagtctaatattagat
gggctttttatggaaattctcaatgactgttctgatgtagatgagatcaaattccaagaa
gatggttcttggtgtccaatgagaccgaagaaagaagctatgaaagtatccagccaaccg
tgtacaaaaatagaaagttcaagcgtcctcagtaagccttgttcagtgactgtagccagt
gaggcaagcaagaagaaagtagatgttattgatcttacaatagaaagctcttctgacgaa
gaggaagaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccatacgcca
atatcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagcagt
acgtctgtcaccaccaccagctcccatgaaagcagtactcatgttagttcatccagcagc
aggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctcattg
gactaa

DBGET integrated database retrieval system