KEGG   Homo sapiens (human): 90634
Entry
90634             CDS       T01001                                 
Symbol
N4BP2L1, CG018
Name
(RefSeq) NEDD4 binding protein 2 like 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: AAA_33 AAA_18 AAA_16 Zeta_toxin AAA_24 KTI12 nSTAND3 AAA_17 AAA_14 Mg_chelatase NACHT AAA_22 AAA_5 AAA CPT Ploopntkinase3 Viral_helicase1 AAA_28 NB-ARC PEPCK_ATP RNA_helicase
Other DBs
NCBI-GeneID: 90634
NCBI-ProteinID: NP_001273388
HGNC: 25037
Ensembl: ENSG00000139597
UniProt: Q5TBK1 Q9Y273
Position
13:complement(32400723..32429615)
AA seq 243 aa
MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLAR
QLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTN
LHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDV
TFHSVLHAEKPSRMNRNQDRNNALPSNNARYWNSYTEFPNRRAHGGFTNESSYHRRGGCH
HGY
NT seq 732 nt   +upstreamnt  +downstreamnt
atggaggacagtttccttcaatcttttgggaggctgagcctccagccccagcagcagcag
cagcggcagcggccgccccggccgcccccgcgggggacacctcctcgccgccacagcttt
aggaaacacctctacctcctgcgaggcctcccgggctccgggaaaactacactggccaga
caattgcagcatgactttcccagggccctgattttcagcacggatgattttttcttcagg
gaagatggtgcctatgagttcaatcctgacttcctggaggaagctcatgaatggaaccaa
aaaagagcaagaaaagcaatgaggaatggcatatcccccattattattgataataccaac
ctccacgcctgggaaatgaagccctatgcagtcatggcacttgaaaataactatgaagtt
atattccgagaacctgacactcgctggaaattcaacgttcaagagttagcaagaagaaac
attcatggtgtctcaagagaaaaaatccaccgaatgaaagaacggtatgaacacgatgtt
acttttcacagtgtgcttcatgcagaaaagccaagcagaatgaacagaaaccaggacagg
aataatgcattgccttccaacaatgccagatactggaattcctacacagagtttccaaac
cggagggcccacggtggatttacaaatgagagctcctatcacagaaggggcggttgtcac
catggatattag

DBGET integrated database retrieval system