KEGG   Homo sapiens (human): 90639
Entry
90639             CDS       T01001                                 
Symbol
COX19
Name
(RefSeq) cytochrome c oxidase assembly factor COX19
  KO
K18183  cytochrome c oxidase assembly protein subunit 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    90639 (COX19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    90639 (COX19)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    90639 (COX19)
SSDB
Motif
Pfam: CHCH Cmc1 NDUF_B7 COX6B Pet191_N
Other DBs
NCBI-GeneID: 90639
NCBI-ProteinID: NP_001026788
OMIM: 610429
HGNC: 28074
Ensembl: ENSG00000240230
Pharos: Q49B96(Tdark)
UniProt: Q49B96
Position
7:complement(964852..975549)
AA seq 90 aa
MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLE
CRMERKLMLQEPLEKLGFGDLTSGKSEAKK
NT seq 273 nt   +upstreamnt  +downstreamnt
atgtcgaccgccatgaatttcgggaccaagagcttccagccgcggcccccggacaagggc
agcttcccgctggatcacttaggtgaatgtaaaagctttaaagagaaattcatgaagtgt
cttcataacaataattttgaaaatgctttgtgcagaaaggaatcaaaagaatatttagaa
tgcaggatggagagaaaattgatgctacaagaaccattggagaaactgggatttggagac
ttgactagtggaaaatcagaggcaaaaaaatga

DBGET integrated database retrieval system