KEGG   Homo sapiens (human): 90655
Entry
90655             CDS       T01001                                 

Gene name
TGIF2LY, TGIFLY
Definition
(RefSeq) TGFB induced factor homeobox 2 like Y-linked
  KO
K19554  homeobox protein TGIF2L
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    90655 (TGIF2LY)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, TGIF
    90655 (TGIF2LY)
SSDB
Motif
Pfam: Homeobox_KN Homeodomain DUF1388
Other DBs
NCBI-GeneID: 90655
NCBI-ProteinID: NP_631960
OMIM: 400025
HGNC: 18569
Ensembl: ENSG00000176679
Vega: OTTHUMG00000036153
Pharos: Q8IUE0(Tdark)
UniProt: Q8IUE0
Position
Yp11.2
AA seq 185 aa
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAE
SVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDP
IIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLA
RSSPE
NT seq 558 nt   +upstreamnt  +downstreamnt
atggaggccgctgcagacggcccggctgagacccaaagcccggtggaaaaagacagcccg
gcgaagacccaaagcccagcccaagacacctcaatcatgtcgagaaataacgcagataca
ggcagagttcttgccttaccagagcacaagaagaagcgcaagggaaacttgccagccgag
tccgttaagatcctccgcgactggatgtataagcatcggtttaaggcctacccttcagaa
gaagagaagcaaatgctgtcagagaagaccaatttgtctttgttgcggatttctaactgg
tttatcaatgctcgcagacgcattctcccggatatgcttcaacagcgtagaaacgacccc
atcattggccacaaaacgggcaaagatgcccatgccacccacctgcagagcaccgaggcg
tctgtgccggccaagtcagggccagtggtccagacaatgtacaaagcctgcccctgtggc
ccttgccaaagggccagatgtcaagagagaagcaaccagatccggagtcggcccctagcc
agaagctcaccggaatag

DBGET integrated database retrieval system