KEGG   Homo sapiens (human): 90693Help
Entry
90693             CDS       T01001                                 

Gene name
CCDC126
Definition
(RefSeq) coiled-coil domain containing 126
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4525
Motif
Other DBs
NCBI-GeneID: 90693
NCBI-ProteinID: NP_620126
HGNC: 22398
Ensembl: ENSG00000169193
Vega: OTTHUMG00000128461
Pharos: Q96EE4(Tdark)
UniProt: Q96EE4 A0A024RA08
Position
7p15.3
AA seq 140 aa AA seqDB search
MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKAL
AEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGT
SGNLVPVTTNKRTNVSGSIR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgttttttacaatctcaagaaaaaatatgtcccagaaattgagtttactgttgcttgta
tttggactcatttggggattgatgttactgcactatacttttcaacaaccaagacatcaa
agcagtgtcaagttacgtgagcaaatactagacttaagcaaaagatatgttaaagctcta
gcagaggaaaataagaacacagtggatgtcgagaacggtgcttctatggcaggatatgcg
gatctgaaaagaacaattgctgtccttctggatgacattttgcaacgattggtgaagctg
gagaacaaagttgactatattgttgtgaatggctcagcagccaacaccaccaatggtact
agtgggaatttggtgccagtaaccacaaataaaagaacgaatgtctcgggcagtatcaga
tag

DBGET integrated database retrieval system