KEGG   Homo sapiens (human): 9070Help
Entry
9070              CDS       T01001                                 

Gene name
ASH2L, ASH2, ASH2L1, ASH2L2, Bre2
Definition
(RefSeq) ASH2 like, histone lysine methyltransferase complex subunit
  KO
K14964  Set1/Ash2 histone methyltransferase complex subunit ASH2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    9070 (ASH2L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9070 (ASH2L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     9070 (ASH2L)
    MLL-HCF complex
     9070 (ASH2L)
    MLL3/MLL4 complex
     9070 (ASH2L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY PHD20L1_u1
Motif
Other DBs
NCBI-GeneID: 9070
NCBI-ProteinID: NP_004665
OMIM: 604782
HGNC: 744
Ensembl: ENSG00000129691
Vega: OTTHUMG00000164016
Pharos: Q9UBL3(Tbio)
UniProt: Q9UBL3
Structure
PDB: 

Position
8p11.23
AA seq 628 aa AA seqDB search
MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGY
GQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSE
IIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWG
AVVEHTLADVLYHVETEVDGRRSPPWEP
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcaggagcaggacctggccaggaagcgggtgccgggcctggcccaggagcg
gtcgcaaatgcaacaggggcagaagagggggagatgaagccggtggcagcgggagcagcc
gctcctcctggagaggggatctctgctgctccgacagttgagcccagttccggggaggct
gaaggcggggaggcaaacttggtcgatgtaagcggtggcttggagacagaatcatctaat
ggaaaagatacactagaaggtgctggggatacatcagaggtgatggatactcaggcgggc
tccgtggatgaagagaatggccgacagttgggtgaggtagagctgcaatgtgggatttgt
acaaaatggttcacggctgacacatttggcatagatacctcatcctgtctacctttcatg
accaactacagttttcattgcaacgtctgccatcacagtgggaatacctatttcctccgg
aagcaagcaaacttgaaggaaatgtgccttagtgctttggccaacctgacatggcagtcc
cgaacacaggatgaacatccgaagacaatgttctccaaagataaggatattataccattt
attgataaatactgggagtgcatgacaaccagacagagacctgggaaaatgacttggcca
aataacattgttaaaacaatgagtaaagaaagagatgtattcttggtaaaggaacaccca
gatccaggcagtaaagatccagaagaagattaccccaaatttggacttttggatcaggac
cttagtaacattggtcctgcttatgacaaccaaaaacagagcagtgctgtgtctactagt
gggaatttaaatgggggaattgcagcaggaagcagcggaaaaggacgaggagccaagcgc
aaacagcaggatggagggaccacagggaccaccaagaaggcccggagtgaccctttgttt
tctgctcagcgccttccccctcatggctacccattggaacacccgtttaacaaagatggc
tatcggtatattctagctgagcctgatccgcacgcccctgaccccgagaagctggaactt
gactgctgggcaggaaaacctattcctggagacctctacagagcctgcttgtatgaacgg
gttttgttagccctacatgatcgagctccccagttaaagatctcagatgaccggctgact
gtggttggagagaagggctactctatggtgagggcctctcatggagtacggaaaggtgcc
tggtattttgaaatcactgtggatgagatgccaccagataccgctgccagactgggttgg
tcccagcccctaggaaaccttcaagctcctttaggttatgataaatttagctattcttgg
cggagcaaaaagggaaccaagttccaccagtccattggcaaacactactcttctggctat
ggacagggagacgtcctgggattttatattaatcttcctgaagacacagagacagccaag
tcattgccagacacatacaaagataaggctttgataaaattcaagagttatttgtatttt
gaggaaaaagactttgtggataaagcagagaagagcctgaagcagactccccatagtgag
ataatattttataaaaatggtgtcaatcaaggtgtggcttacaaagatatttttgagggg
gtttacttcccagccatctcactgtacaagagctgcacggtttccattaactttggacca
tgcttcaagtatcctccgaaggatctcacttaccgccctatgagtgacatgggctggggc
gccgtggtagagcacaccctggctgacgtcttgtatcacgtggagacagaagtggatggg
aggcgcagtcccccatgggaaccctga

DBGET integrated database retrieval system