KEGG   Homo sapiens (human): 9071
Entry
9071              CDS       T01001                                 
Symbol
CLDN10, CPETRL3, HELIX, OSP-L, OSPL
Name
(RefSeq) claudin 10
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H02486  HELIX syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    9071 (CLDN10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9071 (CLDN10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9071 (CLDN10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    9071 (CLDN10)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9071 (CLDN10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    9071 (CLDN10)
   04147 Exosome [BR:hsa04147]
    9071 (CLDN10)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   9071 (CLDN10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9071 (CLDN10)
  Exosomal proteins of colorectal cancer cells
   9071 (CLDN10)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF2207
Other DBs
NCBI-GeneID: 9071
NCBI-ProteinID: NP_008915
OMIM: 617579
HGNC: 2033
Ensembl: ENSG00000134873
Pharos: P78369(Tbio)
UniProt: P78369
Position
13:95433755..95579759
AA seq 228 aa
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGV
SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLA
GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFC
FSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
NT seq 687 nt   +upstreamnt  +downstreamnt
atggctagcacggcttcggagatcatcgccttcatggtctccatctcaggctgggtactg
gtgtcctccacgctgcccaccgactactggaaggtgtctaccatcgacggcacggtcatc
acaaccgccacctattgggccaacctgtggaaggcgtgcgttaccgactccacgggcgtc
tccaactgcaaggacttcccctccatgctggcgctggacggttatatacaggcatgtaga
ggacttatgatcgctgctgtcagcctgggcttctttggttccatatttgcgctctttgga
atgaagtgtaccaaagtcggaggctccgataaagccaaagctaaaattgcttgtttggct
gggattgtattcatactgtcagggctgtgctcaatgactggatgttccctatatgcaaac
aaaatcacaacggaattctttgatcctctctttgttgagcaaaagtatgaattaggagcc
gctctgtttattggatgggcaggagcctcactgtgcataattggtggtgtcatattttgc
ttttcaatatctgacaacaacaaaacacccagatacacatacaacggggccacatctgtc
atgtcttctcggacaaagtatcatggtggagaagattttaaaacaacaaacccttcaaaa
cagtttgataaaaatgcttatgtctaa

DBGET integrated database retrieval system