KEGG   Homo sapiens (human): 90737Help
Entry
90737             CDS       T01001                                 

Gene name
PAGE5, CT16, CT16.1, CT16.2, GAGEE1, PAGE-5
Definition
(RefSeq) PAGE family member 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GAGE
Motif
Other DBs
NCBI-GeneID: 90737
NCBI-ProteinID: NP_569734
OMIM: 301009
HGNC: 29992
Ensembl: ENSG00000158639
Vega: OTTHUMG00000021650
Pharos: Q96GU1(Tdark)
UniProt: Q96GU1
Position
Xp11.21
AA seq 130 aa AA seqDB search
MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEE
PPTDNQGIAPSGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPT
KVLEAGEGQL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgccatgggccggtaatcgtggctgggctggaacgagggaggaagtgagagat
atgagtgagcatgtaacaagatcccaatcctcagaaagaggaaatgaccaagagtcttcc
cagccagttggacctgtgattgtccagcagcccactgaggaaaaacgtcaagaagaggaa
ccaccaactgataatcagggtattgcacctagtggggagatcaaaaatgaaggagcacct
gctgttcaagggactgatgtggaagcttttcaacaggaactggctctgcttaagatagag
gatgcacctggagatggtcctgatgtcagggaggggactctgcccacttttgatcccact
aaagtgctggaagcaggtgaagggcaactatag

DBGET integrated database retrieval system