KEGG   Homo sapiens (human): 9076Help
Entry
9076              CDS       T01001                                 

Gene name
CLDN1, CLD1, ILVASC, SEMP1
Definition
(RefSeq) claudin 1
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H00742  Neonatal ichthyosis-sclerosing cholangitis (NISCH) syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9076 (CLDN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9076 (CLDN1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9076 (CLDN1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9076 (CLDN1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    9076 (CLDN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9076 (CLDN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9076 (CLDN1)
  Exosomal proteins of colorectal cancer cells
   9076 (CLDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF2613 Amastin SUR7 Cytochrom_B_C YccF DUF4064
Motif
Other DBs
NCBI-GeneID: 9076
NCBI-ProteinID: NP_066924
OMIM: 603718
HGNC: 2032
Ensembl: ENSG00000163347
Vega: OTTHUMG00000156214
Pharos: O95832(Tbio)
UniProt: O95832 A5JSJ9
Position
3q28
AA seq 211 aa AA seqDB search
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG
QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV
IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA
LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcggggctgcagctgttgggcttcattctcgccttcctgggatggatcggc
gccatcgtcagcactgccctgccccagtggaggatttactcctatgccggcgacaacatc
gtgaccgcccaggccatgtacgaggggctgtggatgtcctgcgtgtcgcagagcaccggg
cagatccagtgcaaagtctttgactccttgctgaatctgagcagcacattgcaagcaacc
cgtgccttgatggtggttggcatcctcctgggagtgatagcaatctttgtggccaccgtt
ggcatgaagtgtatgaagtgcttggaagacgatgaggtgcagaagatgaggatggctgtc
attgggggtgcgatatttcttcttgcaggtctggctattttagttgccacagcatggtat
ggcaatagaatcgttcaagaattctatgaccctatgaccccagtcaatgccaggtacgaa
tttggtcaggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc
ctactttgctgttcctgtccccgaaaaacaacctcttacccaacaccaaggccctatcca
aaacctgcaccttccagcgggaaagactacgtgtga

DBGET integrated database retrieval system