KEGG   Homo sapiens (human): 908Help
Entry
908               CDS       T01001                                 

Gene name
CCT6A, CCT-zeta, CCT-zeta-1, CCT6, Cctz, HTR3, MoDP-2, TCP-1-zeta, TCP20, TCPZ, TTCP20
Definition
(RefSeq) chaperonin containing TCP1 subunit 6A
  KO
K09498  T-complex protein 1 subunit zeta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    908 (CCT6A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    908 (CCT6A)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   908 (CCT6A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   908 (CCT6A)
  Exosomal proteins of colorectal cancer cells
   908 (CCT6A)
  Exosomal proteins of bladder cancer cells
   908 (CCT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 908
NCBI-ProteinID: NP_001753
OMIM: 104613
HGNC: 1620
Ensembl: ENSG00000146731
Vega: OTTHUMG00000022842
Pharos: P40227(Tbio)
UniProt: P40227 A0A024RDL1
Structure
PDB: 

Position
7p11.2
AA seq 531 aa AA seqDB search
MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG
NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT
EGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIK
KQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYE
KTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPF
SLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKF
TFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVD
LNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgaagaccctgaaccccaaggccgaggtggcccgagcgcaggcggcgctg
gcggtcaacatcagcgcagcgcggggtctgcaggacgtgctaaggaccaacctggggccc
aagggcaccatgaagatgctcgtttctggcgctggagacatcaaacttactaaagacggc
aatgtgctgcttcacgaaatgcaaattcaacacccaacagcttccttaatagcaaaggta
gcaacagcccaggatgatataactggtgatggtacgacttctaatgtcctaatcattgga
gagctgctgaaacaggcggatctctacatttctgaaggccttcatcctagaataatcact
gaaggatttgaagctgcaaaggaaaaggcccttcagtttttggaagaagtcaaagtaagc
agagagatggacagggaaacacttatagatgtggccagaacatctcttcgtactaaagtt
catgctgaacttgcagatgtcttaacagaggctgtagtggactccattttggccattaaa
aagcaagatgaacctattgatctcttcatgattgagatcatggagatgaaacataaatct
gaaactgatacaagcttaatcagagggcttgttttggaccacggagcacggcatcctgat
atgaagaaaagggtggaggatgcatacatcctcacttgtaacgtgtcattagagtatgag
aaaacagaagtgaattctggctttttttacaagagtgcagaagagagagaaaaactcgtg
aaagctgaaagaaaattcattgaagatagggttaaaaaaataatagaactgaaaaggaaa
gtctgtggcgattcagataaaggatttgttgttattaatcaaaagggaattgaccccttt
tccttagatgctctttcaaaagaaggcatagttgctctgcgcagagctaaaaggagaaat
atggagaggctgactcttgcttgtggtggggtagccctgaattcttttgacgacctaagt
cctgactgcttgggacatgcaggacttgtatatgagtatacattgggagaagagaagttt
acctttattgagaaatgtaacaaccctcgttctgtcacattattgatcaaaggaccaaat
aagcacacactcactcagatcaaagatgcagtgagggacggcttgagggctgtcaaaaat
gctattgatgatggctgtgtggttccaggtgctggtgccgtggaagtggcaatggcagaa
gccctgattaaacataagcccagtgtaaagggcagggcacagcttggagtccaagcattt
gctgatgcattgctcattattcccaaggttcttgctcagaactctggttttgaccttcag
gaaacattagttaaaattcaagcagaacattcagaatcaggtcagcttgtgggtgtggac
ctgaacacaggtgagccaatggtggcagcagaagtaggcgtatgggataactattgtgta
aagaaacagcttcttcactcctgcactgtgattgccaccaacattctcttggttgatgag
atcatgcgagctggaatgtcttctctgaaaggttga

DBGET integrated database retrieval system