KEGG   Homo sapiens (human): 9082Help
Entry
9082              CDS       T01001                                 

Gene name
XKRY, XKRY1
Definition
(RefSeq) XK related, Y-linked
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: XK-related
Motif
Other DBs
NCBI-GeneID: 9082
NCBI-ProteinID: NP_004668
OMIM: 400015
HGNC: 18571
Ensembl: ENSG00000250868
Pharos: A2RUG3(Tdark) O14609(Tdark)
UniProt: A2RUG3 O14609
Position
Yq11.222
AA seq 117 aa AA seqDB search
MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV
TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctttaatagcattgctgatgacatattccctcttatcagttgtgtaggtgcc
attcactgcaatatactggccatccgcactggcaacgactttgctgccattaagctacag
gtgataaaattgatctatctcatgatatggcattcgttggtgattatctcacctgtagtg
actctggcattcttccctgcatctctgaaacaggggagcttacactttctattaatcata
tattttgtattattgttgacaccatggctggagttttcgaaaagtggaactcatcttcct
agcaacacaaaaaataattccagcatggtgggtaagtatggatgcttatcttaa

DBGET integrated database retrieval system