KEGG   Homo sapiens (human): 90826
Entry
90826             CDS       T01001                                 
Symbol
PRMT9, PRMT10
Name
(RefSeq) protein arginine methyltransferase 9
  KO
K19737  type II protein arginine methyltransferase [EC:2.1.1.320]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    90826 (PRMT9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.320  type II protein arginine methyltransferase
     90826 (PRMT9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     90826 (PRMT9)
SSDB
Motif
Pfam: PrmA TPR_2 Methyltransf_25 TPR_1 MTS RrnaAD Met_10 DREV Methyltransf_23 Methyltransf_11 Methyltransf_18 Methyltransf_16
Other DBs
NCBI-GeneID: 90826
NCBI-ProteinID: NP_612373
OMIM: 616125
HGNC: 25099
Ensembl: ENSG00000164169
Vega: OTTHUMG00000161361
Pharos: Q6P2P2(Tdark)
UniProt: Q6P2P2
Structure
Position
4:complement(147637785..147684163)
AA seq 845 aa
MSNSRPRSRRDAGGGAGAAGRDELVSRSLQSAEHCLGVQDFGTAYAHYLLVLSLAPELKH
DVKETFQYTLFRWAEELDALSRIQDLLGCYEQALELFPDDEVICNSMGEHLFRMGFRDEA
AGYFHKAVKLNPDFSDAKENFYRVANWLVERWHFIMLNDTKRNTIYNAAIQKAVCLGSKS
VLDIGAGTGILSMFAKKAGAHSVYACELSKTMYELACDVVAANKMEAGIKLLHTKSLDIE
IPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQPKTKGESANCEKYGKVIPAS
AVIFGMAVECAEIRRHHRVGIKDIAGIHLPTNVKFQSPAYSSVDTEETIEPYTTEKMSRV
PGGYLALTECFEIMTVDFNNLQELKSLATKKPDKIGIPVIKEGILDAIMVWFVLQLDDEH
SLSTSPSEETCWEQAVYPVQDLADYWIKPGDHVMMEVSCQDCYLRIQSISVLGLECEMDV
AKSFTQNKDLLSLGNEAELCSALANLQTSKPDAVEQTCILESTEIALLNNIPYHEGFKMA
MSKVLSSLTPEKLYQTMDTHCQNEMSSGTGQSNTVQNILEPFYVLDVSEGFSVLPVIAGT
LGQVKPYSSVEKDQHRIALDLISEANHFPKETLEFWLRHVEDESAMLQRPKSDKLWSIII
LDVIEPSGLIQQEIMEKAAISRCLLQSGGKIFPQYVLMFGLLVESQTLLEENAVQGTERT
LGLNIAPFINQFQVPIRVFLDLSSLPCIPLSKPVELLRLDLMTPYLNTSNREVKVYVCKS
GRLTAIPFWYHMYLDEEIRLDTSSEASHWKQAAVVLDNPIQVEMGEELVLSIQHHKSNVS
ITVKQ
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgtcgaactcgcggcccaggtcccgccgagacgccgggggtggcgctggggcagccggc
cgggacgagctggtgtcgcggtccttgcagagcgcagagcactgtctgggcgtccaggac
ttcggcactgcctatgcccactacctcctcgtgctcagcctggcgccggagctgaaacac
gacgtgaaggaaacttttcagtacacacttttcagatgggctgaagagcttgatgctctc
agtcggatacaagacttacttggttgctatgagcaggccttggaactgtttcctgatgat
gaagtgatttgcaatagtatgggggagcatctcttcagaatgggctttagggatgaagca
gctgggtattttcataaagcagtgaagctaaaccctgatttcagtgatgcaaaggagaat
ttttatcgtgttgcaaactggttggtggaacgctggcactttatcatgcttaatgacacc
aagaggaatacaatttataatgcagcaatccaaaaggcagtttgtttggggtccaaaagt
gttttggacattggagcaggaactggaatactaagcatgtttgctaaaaaagctggagca
cattccgtgtatgcctgtgagttatccaagaccatgtatgaacttgcctgtgatgtcgtg
gcagcaaacaagatggaagcagggatcaaactcttacatacgaagtcacttgacatagag
attccaaaacatattcccgaaagagtgtccctagttgtaacagaaactgtcgatgcaggt
ttatttggagaaggaattgtggagagtttgattcatgcatgggagcatttacttttacag
ccaaagaccaaaggtgaaagtgctaattgtgaaaagtatgggaaagttataccagcaagt
gctgttatatttgggatggcagtagaatgtgcagagataagaagacatcatagagtgggt
attaaggacattgctggtatccatttgccaacaaatgtgaaatttcagagtccggcttat
tcttctgtagatactgaagaaacaattgaaccttatacaactgaaaagatgagtcgagtt
cctggaggatatttggctttgacagagtgctttgaaattatgacagtagatttcaacaac
cttcaggaattaaaaagtcttgcaactaaaaagcctgataagattggtattcctgttatt
aaagaaggcatactagatgctattatggtttggtttgtgctccagcttgatgatgaacat
agtttatccacaagtcctagtgaggaaacatgttgggaacaggctgtctaccccgtacag
gaccttgcagactactggataaagcctggagaccatgtgatgatggaagtatcttgtcaa
gactgttacttaagaatccagagtattagtgtcttgggtttggaatgtgaaatggatgtt
gcaaaaagttttacccagaataaagacttgttatcgttaggaaatgaggctgaactttgt
agtgccctcgctaaccttcagaccagtaaaccagatgctgtagagcagacatgtatattg
gaatctacagaaattgctttgcttaacaacatcccatatcatgaaggctttaaaatggca
atgagcaaagttttgtcttcactgactccagagaaactgtatcagaccatggatactcac
tgtcagaatgagatgagctctggaactggacagagtaatactgtacagaacatccttgaa
cctttctacgtgttagatgtgtccgaaggcttctctgttctgcctgttattgctggcaca
cttgggcaggttaaaccatacagttctgtggagaaagaccagcatcgtattgctctggac
ctcatatctgaagccaatcactttcctaaagaaacacttgagttttggctgagacatgtg
gaggatgaatctgctatgttacaaaggccaaaatcagacaagttatggagcataattata
ttggatgtcattgagccatctgggctcattcagcaggaaataatggaaaaagctgcaata
tccaggtgtttactacaatctggaggcaagatctttcctcagtatgtgctgatgtttggg
ttgcttgtggaatcacagacactcctagaggagaatgctgttcaaggaacagaacgtact
cttggattaaatatagcaccttttattaaccagtttcaggtacctatacgtgtatttttg
gacctatcctcattgccctgtatacctttaagcaagccagtggaactcttaagactagat
ttaatgactccgtatttgaacacctctaacagagaagtaaaggtatacgtttgtaaatct
ggaagactgactgctattccattttggtatcatatgtaccttgatgaagagattaggttg
gatacttcaagtgaagcctcccactggaaacaagctgcagttgttttagataatcccatc
caggttgaaatgggagaggaacttgtactcagcattcagcatcacaaaagcaatgtcagc
atcacagtaaagcaatga

DBGET integrated database retrieval system