KEGG   Homo sapiens (human): 9085Help
Entry
9085              CDS       T01001                                 

Gene name
CDY1, CDY, CDY1A
Definition
(RefSeq) chromodomain Y-linked 1
  KO
K00653  chromodomain protein Y [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9085 (CDY1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     9085 (CDY1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    9085 (CDY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Chromo Mrr_cat Mtf2_C Tudor-knot
Motif
Other DBs
NCBI-GeneID: 9085
NCBI-ProteinID: NP_733841
OMIM: 400016
HGNC: 1809
Ensembl: ENSG00000172288
Vega: OTTHUMG00000045274
Pharos: Q9Y6F8(Tbio)
UniProt: Q9Y6F8
Structure
PDB: 

Position
Yq11.23
AA seq 540 aa AA seqDB search
MASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTE
KQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNRKLFAASKNVRR
KAASILSDTKNMEIINSTIETLAPDSPFDHKTVSGFQKLEKLDPIAADQQDTVVFKVTEG
KLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSVTASMATGSATRKGIVVLIDPLAANGT
TDMHTSVPRVKGGQRNITDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLS
TRSTEKNALNTEVIKEIVNALNSAAADDSKLVLFSAAGSVFCCGLDFGYFVKHLRNNRNT
ASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTF
GQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIK
ELASYNPIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccaggagtttgaggttgaagctattgttgacaaaagacaggataaaaatggg
aatacacagtatttggttcggtggaaaggttatgacaaacaggatgacacttgggaacca
gagcagcacctcatgaactgtgaaaaatgtgtacatgattttaatagacgacagactgaa
aaacagaaaaaactgacatggactacaaccagtagaattttttcaaacaatgccagaaga
agaacttccagatctacaaaagcaaactattctaagaactctcctaaaacgccagtgact
gataaacaccacaggtccaaaaaccgcaagttatttgctgccagcaagaacgttaggaga
aaggcagcttcaattctctccgacacaaagaatatggagataataaattcaactattgag
acccttgcacctgacagcccctttgaccacaaaactgtgagtggctttcagaaacttgag
aaactggaccctattgcagcagatcagcaggacacggtggtcttcaaggtgacagaaggg
aaactcctccgggaccctttgtcacgtcctggtgcagaacagactggaatacagaacaag
actcagatacacccactaatgtcgcagatgtctggctcagttactgcttctatggccaca
ggttcagctacccgaaagggtatagtggtattaatagacccattagcagccaatgggaca
acagacatgcatacctcagttccaagagtgaaaggtgggcaaagaaatattactgatgac
agcagagaccagccttttatcaagaagatgcacttcaccataaggctaacagaaagtgcc
agcacatacagagacattgtagtgaagaaagaggatggattcacccagatagtgctatca
actagatcgacagaaaaaaatgcactgaatacagaagtaattaaagaaatagttaatgct
ctgaatagcgctgctgcagatgacagcaagctcgtgctgttcagtgcagctggaagtgtc
ttttgctgcggtcttgattttgggtactttgtgaagcacttaaggaataacagaaacaca
gcaagccttgaaatggtggacaccatcaagaactttgtgaatacttttattcaatttaaa
aagcctattgttgtatcagtcaatggccctgcgattggactaggtgcatccatcctgcct
ctttgtgatctcgtgtgggctaatgaaaaggcttggttccaaaccccttatacgaccttt
ggacagagtccagatggctgttcttctattacattccccaaaatgatgggtaaagcatct
gccaatgaaatgttaattgctgggcgaaagctgacagcaagggaggcatgcgccaaaggc
ctggtctctcaggtatttttgactggaactttcacccaagaggttatgattcaaattaag
gagcttgcctcatacaatccaattgtactggaagaatgtaaggccctcgttcgctgtaat
attaagttggagttggaacaggccaatgagagagagtgtgaggtgctgaggaagatctgg
agctcagcccaagggatagaatccatgttaaagtatgttgaaaataaaattgatgagttt
taa

DBGET integrated database retrieval system