KEGG   Homo sapiens (human): 9086Help
Entry
9086              CDS       T01001                                 

Gene name
EIF1AY, eIF-4C
Definition
(RefSeq) eukaryotic translation initiation factor 1A Y-linked
  KO
K03236  translation initiation factor 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    9086 (EIF1AY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    9086 (EIF1AY)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-1
    9086 (EIF1AY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-1a
Motif
Other DBs
NCBI-GeneID: 9086
NCBI-ProteinID: NP_004672
OMIM: 400014
HGNC: 3252
Ensembl: ENSG00000198692
Vega: OTTHUMG00000036544
Pharos: O14602(Tdark)
UniProt: O14602
Position
Yq11.223
AA seq 144 aa AA seqDB search
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCH
IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
FGPGDDDEIQFDDIGDDDEDIDDI
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaataaaggtaaaggaggtaaaaacaggcgcaggggtaaaaatgagaatgaa
tctgaaaaaagagagttggtgtttaaagaggatggacaagagtatgctcaggtaatcaaa
atgttgggaaatggacgattggaagcattgtgttttgatggtgtaaagaggttatgccat
atcagagggaaattgagaaaaaaggtttggataaatacatcagacattatattggttggt
ctacgggactatcaggataacaaagctgatgtaattttaaagtacaatgcagatgaagct
agaagcctgaaggcatatggcgagcttccagaacatgctaaaatcaatgaaacagacaca
tttggtcctggagatgatgatgaaatccagtttgacgatattggagatgatgatgaagac
attgatgatatctaa

DBGET integrated database retrieval system