KEGG   Homo sapiens (human): 90865Help
Entry
90865             CDS       T01001                                 

Gene name
IL33, C9orf26, DVS27, IL1F11, NF-HEV, NFEHEV
Definition
(RefSeq) interleukin 33
  KO
K12967  interleukin 33
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04217  Necroptosis
hsa04623  Cytosolic DNA-sensing pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    90865 (IL33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    90865 (IL33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    90865 (IL33)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    90865 (IL33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL33 AbfB
Motif
Other DBs
NCBI-GeneID: 90865
NCBI-ProteinID: NP_001300973
OMIM: 608678
HGNC: 16028
Ensembl: ENSG00000137033
Vega: OTTHUMG00000019516
Pharos: O95760(Tbio)
UniProt: O95760
Structure
PDB: 

Position
9p24.1
AA seq 270 aa AA seqDB search
MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYF
RRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPIT
EYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGK
MLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFI
GVKDNHLALIKVDSSENLCTENILFKLSET
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctaaaatgaagtattcaaccaacaaaatttccacagcaaagtggaagaacaca
gcaagcaaagccttgtgtttcaagctgggaaaatcccaacagaaggccaaagaagtttgc
cccatgtactttatgaagctccgctctggccttatgataaaaaaggaggcctgttacttt
aggagagaaaccaccaaaaggccttcactgaaaacaggtagaaagcacaaaagacatctg
gtactcgctgcctgtcaacagcagtctactgtggagtgctttgcctttggtatatcaggg
gtccagaaatatactagagcacttcatgattcaagtatcacaggaatttcacctattaca
gagtatcttgcttctctaagcacatacaatgatcaatccattacttttgctttggaggat
gaaagttatgagatatatgttgaagacttgaaaaaagatgaaaagaaagataaggtgtta
ctgagttactatgagtctcaacacccctcaaatgaatcaggtgacggtgttgatggtaag
atgttaatggtaaccctgagtcctacaaaagacttctggttgcatgccaacaacaaggaa
cactctgtggagctccataagtgtgaaaaaccactgccagaccaggccttctttgtcctt
cataatatgcactccaactgtgtttcatttgaatgcaagactgatcctggagtgtttata
ggtgtaaaggataatcatcttgctctgattaaagtagactcttctgagaatttgtgtact
gaaaatatcttgtttaagctctctgaaacttag

DBGET integrated database retrieval system